(data stored in ACNUC30630 zone)

EMBL: FP565814.PE138

FP565814.PE138       Location/Qualifiers
FT   CDS_pept        175917..176132
FT                   /transl_table=11
FT                   /locus_tag="SRM_00138"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SRM_00138"
FT                   /db_xref="EnsemblGenomes-Tr:CBH23059"
FT                   /db_xref="UniProtKB/TrEMBL:D5H4V4"
FT                   /protein_id="CBH23059.1"
FT                   /translation="MFDEEHFPREYECEGCSTTATVTHEDVQDVPSFLAATTVAEAVEY
FT                   VMTERRRWSLQSFEGAFCPACMEETD"
     atgtttgacg aagagcactt tccccgagag tacgagtgcg aaggctgctc cacgaccgcc        60
     acggttacgc acgaggacgt gcaggatgtg ccgtccttcc ttgcggccac gaccgtggcg       120
     gaggcggtcg agtacgtgat gactgaacgc cgtcggtggt cgctccagtc gttcgagggg       180
     gcgttctgcc ccgcctgcat ggaggagaca gactga                                 216
//

If you have problems or comments...

PBIL Back to PBIL home page