(data stored in ACNUC30630 zone)

EMBL: FP565814.PE163

FP565814.PE163       Location/Qualifiers
FT   CDS_pept        complement(199738..200160)
FT                   /transl_table=11
FT                   /locus_tag="SRM_00163"
FT                   /product="Conserved hypothetical protein, membrane or
FT                   secreted"
FT                   /db_xref="EnsemblGenomes-Gn:SRM_00163"
FT                   /db_xref="EnsemblGenomes-Tr:CBH23084"
FT                   /db_xref="GOA:D5H4X9"
FT                   /db_xref="UniProtKB/TrEMBL:D5H4X9"
FT                   /protein_id="CBH23084.1"
FT                   /translation="MFGTSGVLFGSVVVWGAAAIWAAGTLTLLISSFAPTEHEGPTRLP
FT                   AWDGPPPRVSGPYRTASGTGPHNADGPVGPPGASSRRSGLLGPHSQLGSMDRPRPLVRS
FT                   LRAHLDQRPHLDRRHGASPPGTRPLHWLPFRSPRPW"
     atgtttggaa cgtccggtgt gctatttggg tcggtggtcg tctggggcgc agccgcaatc        60
     tgggcggcag gcacgctgac gctcctgatc tcttctttcg ccccgacgga acacgaaggg       120
     ccaacccggc tccccgcttg ggacggtcct cccccgcgtg tctccggccc ctacagaacg       180
     gcatccggga ccgggcccca caatgcagac gggccggttg ggcctccagg cgcctcttcc       240
     cgccgctccg gcctgctagg gccccacagt caactcggct ccatggaccg gccccgcccg       300
     ttggttcgct ccctccgcgc ccatcttgac caacggcccc atcttgaccg acggcacggc       360
     gcctcgcccc ccggcacgcg tcccctgcac tggctgccat tcaggtcccc gcgcccgtgg       420
     tag                                                                     423
//

If you have problems or comments...

PBIL Back to PBIL home page