(data stored in ACNUC30630 zone)

EMBL: FP565814.PE175

FP565814.PE175       Location/Qualifiers
FT   CDS_pept        complement(219814..220734)
FT                   /transl_table=11
FT                   /locus_tag="SRM_00175"
FT                   /product="Conserved hypothetical protein containing CAAX
FT                   amino terminal protease domain, membrane"
FT                   /db_xref="EnsemblGenomes-Gn:SRM_00175"
FT                   /db_xref="EnsemblGenomes-Tr:CBH23096"
FT                   /db_xref="GOA:D5H4Z1"
FT                   /db_xref="InterPro:IPR003675"
FT                   /db_xref="InterPro:IPR042150"
FT                   /db_xref="UniProtKB/TrEMBL:D5H4Z1"
FT                   /protein_id="CBH23096.1"
FT                   /translation="MPTGYPGLPDVLLSLFHTLQHLMPETIRSNVRRFPTATFFILTFL
FT                   FSWGYLGLTFGLIGTGASGPVQVPFAWGPLFGGLLTVWLLGESVSGWLGQVGRWRAGLR
FT                   WYLLGIGILVVGKEMPNLVAWLLGADVSLVAGTEVPIVGYLVSMGITLFVAGALEEFGW
FT                   RGFAQVRLQKQYGAVAASLFVGGMWALWHLPFLLLGVGGFDSFYVYVPEVMAFSVLLGW
FT                   LYNATKGALPVVMITHAAHNRPDLLGVSGQMPPLAQSVPWDGVFYVLVMAVVIWQVGAR
FT                   TLSGDGRLPEIPGKAPASASQAPAE"
     atgcctaccg ggtatcctgg gctcccagat gtcctcctga gccttttcca cacccttcaa        60
     cacctcatgc ccgagaccat tcgctcgaac gttcggcgct tccccaccgc gacatttttc       120
     atcctgacgt ttctcttttc gtgggggtac ctcggactga cgtttggctt gatcgggacc       180
     ggcgcttctg gaccggttca ggtgcctttc gcctgggggc cgcttttcgg aggactcctc       240
     accgtctggc tgctggggga gagcgtctcg ggctggctcg ggcaggtggg gcgctggcgc       300
     gcaggcctgc gctggtacct gctgggaatc gggattctcg tggtcgggaa ggagatgccg       360
     aatctcgtgg cgtggctgct cggggcggac gtgtcgcttg tcgccgggac ggaggtcccc       420
     attgtggggt acctcgtcag catggggatc acgctgtttg tggccggggc ccttgaggaa       480
     ttcgggtggc gaggcttcgc ccaggtgcgg ctccagaaac agtacggtgc cgtcgccgcg       540
     agcctcttcg tgggcgggat gtgggccctg tggcacctgc cgttccttct gctgggcgtg       600
     ggtgggttcg attccttcta cgtgtacgtg ccggaggtaa tggccttctc ggtcttgctg       660
     ggctggctgt acaacgcgac gaagggggcg cttccagtag tcatgattac ccacgcggcg       720
     cacaaccggc cggatctgct tggggtgtcg ggacagatgc cgcccctcgc ccagagcgtg       780
     ccctgggacg gggtgtttta cgtcctcgtg atggcagtcg tgatctggca ggtgggcgcc       840
     cgcacgcttt ccggagacgg gaggctgcct gagatcccag gaaaagcgcc ggcaagcgcc       900
     agtcaggccc ccgccgagtg a                                                 921
//

If you have problems or comments...

PBIL Back to PBIL home page