(data stored in ACNUC30630 zone)

EMBL: FP565814.PE177

FP565814.PE177       Location/Qualifiers
FT   CDS_pept        complement(222296..223258)
FT                   /transl_table=11
FT                   /locus_tag="SRM_00177"
FT                   /product="Vitamin B12-dependent methionine synthase family
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:SRM_00177"
FT                   /db_xref="EnsemblGenomes-Tr:CBH23098"
FT                   /db_xref="GOA:D5H4Z3"
FT                   /db_xref="InterPro:IPR003726"
FT                   /db_xref="InterPro:IPR017226"
FT                   /db_xref="InterPro:IPR036589"
FT                   /db_xref="UniProtKB/TrEMBL:D5H4Z3"
FT                   /protein_id="CBH23098.1"
FT                   /translation="MRDLSTRLSGGPVLLDGGLGQELIRRGMPGTEPSLWSANALTEAP
FT                   DLVQEVHEEYLRAGADVITTNTYATPPERLSEAGLDGRAEALNREAGRLAERARAAVGR
FT                   DALIAGSLPPIRGSYRPDLVGEAGEIEPQYREQAGYLAPHVDLFLCETMSTPGEAQAAA
FT                   RGAASTGLPVLVSYTIADPSSPEDAEPRLRNGESLEEAVEALSGLPVEGVLLNCSHPES
FT                   ISAAVPVLRQLTDRAVGAYANAFTHIPDGFDERADALDSDARPDRREDFAPEAYGRHVE
FT                   DWLSAGADIVGGCCEVRPGHIAHLRTTVDGAADARRAAE"
     atgcgcgatc tttcgacgcg actctccggc ggccccgtgc tgctcgacgg cggcctgggc        60
     caggagctca tccgccgggg catgccaggc acggagccgt cactctggtc cgccaatgcc       120
     ctgaccgaag cccccgacct ggtgcaggag gtgcacgaag agtacctgcg tgcaggcgcg       180
     gacgtgatca ccaccaacac ctacgccacg cccccggagc gcctctcgga ggctggacta       240
     gacggccggg cggaggcgct caaccgagag gcgggccgcc tggcggagcg cgcacgggcg       300
     gcggtcggcc gcgacgccct cattgcggga tcgctgcccc cgattcgggg gagttaccgg       360
     cccgacctgg tgggcgaggc gggcgagatc gagccccagt accgcgagca ggccggctac       420
     ctggcccccc acgtcgacct cttcctctgt gagaccatgt cgactccggg cgaggcccag       480
     gcggcggccc gaggggccgc gtcgaccggc cttccggtgc tggtctcgta cacgattgca       540
     gacccgtcgt cgccggagga cgccgagccg cgccttcgca acggcgagtc ccttgaggag       600
     gcggtcgagg cgctgtcggg gcttccggtg gagggcgtgc tgctgaactg ctcccatccc       660
     gaaagcatct cggcggccgt gccggtcctc cgccagctga ccgaccgggc agtcggcgct       720
     tacgccaacg cgttcaccca cattccggac ggcttcgacg agcgcgcgga cgcgctggac       780
     tcggacgcca ggcccgaccg gcgcgaggac tttgctcccg aggcctacgg caggcacgtc       840
     gaagactggc tgagcgccgg tgccgacatc gtcggcgggt gctgcgaggt gaggccgggg       900
     cacatcgccc acctgcgcac cacggtcgat ggcgcagcgg atgcgcgccg ggcggcagaa       960
     taa                                                                     963
//

If you have problems or comments...

PBIL Back to PBIL home page