(data stored in ACNUC30630 zone)

EMBL: FP565814.PE178

FP565814.PE178       Location/Qualifiers
FT   CDS_pept        complement(224069..225697)
FT                   /transl_table=11
FT                   /locus_tag="SRM_00178"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SRM_00178"
FT                   /db_xref="EnsemblGenomes-Tr:CBH23099"
FT                   /db_xref="UniProtKB/TrEMBL:D5H4Z4"
FT                   /protein_id="CBH23099.1"
FT                   /translation="MRGSSGLAPVGCYTLFLETEGCNGISTREGGALSGSDSFTPAAIA
FT                   IQCAIRCSAGRPGDGSRYEQLSWGPVPWPSPPGRAGRARLPIPPHEGRPPAHARQVVDL
FT                   FSAPFWGPFRVDVFPPVRSGPSRAAGTQHFTGEENAGRHASCQLGGPQAGIKTQKALND
FT                   DMIRDEDIPLRNPSVEAHRVTGGAVLHDLGRDQVFAVTALAREVWEHCDGNTPLQKIDR
FT                   RVSDRADIPSPTSPDGLRQVVSHLSDQDLLFVHRPDPTADGGAAVGRGDQADGPGATTL
FT                   NVVFGNHQVKVKTTTPRLERAVRRLFHGLIGRETGAETVDVLTAEEAGDGVSVRSPQAR
FT                   GGEASPLTAAVQRLKRTVLLRFMEARRDLIWLHAGAAARNGTAVLVAGPSGGGKSTTIA
FT                   DLCRSGWTHVSDDLTPYDPDTGRVVPLPVTIAYRQPGEKQSLEEGPSGLPKTHVDLEAG
FT                   RLQDAPVRPEAIFFPAFEADRPAGVEEQAAPEAAVSLVESCQNASRHRGEAVRELSRLA
FT                   GRVSSFRLRHDGQTDIGELLAPVLG"
     gtgcgtgggt caagcggctt ggcaccggtc ggttgttaca ccctcttcct tgaaaccgag        60
     ggatgcaacg gaatttcaac gagagaaggg ggcgcgttga gcggaagcga ctcgttcacg       120
     cccgcggcga tcgccattca atgtgccatt cgatgttcgg cggggcgacc tggggacggc       180
     agtcgttatg agcagctgag ctggggacca gtgccctggc cttccccgcc aggccgtgcg       240
     ggaagggccc ggctgccgat tcccccgcac gagggacggc cgcccgccca cgcgaggcag       300
     gtcgtggacc tcttctctgc cccattctgg ggccccttcc gtgtcgatgt cttccccccg       360
     gttcggtctg gccccagcag ggccgcgggc actcagcact tcaccgggga ggagaacgcc       420
     ggccgccacg cctcgtgtca gttgggcggc ccgcaggcgg gcatcaagac gcaaaaggcc       480
     ctgaacgacg acatgatacg agacgaagac attcccctcc gcaatccgtc ggtggaggcc       540
     caccgcgtca caggcggtgc cgtcctgcac gacttggggc gggaccaggt ctttgcggta       600
     accgccctcg cacgagaggt ctgggagcac tgtgacggca acacgcccct ccaaaagatc       660
     gaccggaggg tcagtgatcg tgccgacatc ccctcgccca cgtcccccga cggtctacga       720
     caagtcgttt ctcatttgag cgaccaggac ctcctgttcg tccatcgccc tgatccgacc       780
     gccgacggcg gcgcggcggt gggccgcggc gaccaggccg atggaccggg ggcaacgacg       840
     ctgaacgttg tgtttgggaa ccaccaggtg aaagtgaaga ccaccacgcc gagattggag       900
     cgagccgtgc gccgcctgtt ccacggcctg atcggcaggg agacgggcgc cgagaccgtc       960
     gacgtgctta ccgcggagga ggcgggcgac ggggtctccg tccggtcccc gcaggcacgg      1020
     ggcggcgagg caagcccgct cacagccgca gtgcagcgcc tgaagcgcac ggttctgctg      1080
     cggttcatgg aagcgcgccg ggacctgatc tggctccacg ccggggcggc agcccgaaac      1140
     ggaaccgccg tgctggtggc cgggccatcc ggcggtggaa aaagcacgac gattgcggac      1200
     ctctgtcgct ccggatggac gcacgtgtcc gacgacctca cgccgtacga ccccgacacg      1260
     ggccgggtcg tcccccttcc ggtgacgatc gcgtaccgcc agcccggcga gaaacagtcc      1320
     ctggaggaag ggccgtccgg gcttccaaag acgcatgtgg acctggaggc cggccgtctt      1380
     caagacgcgc ccgtccggcc ggaggccatt ttctttccgg ctttcgaggc ggaccgcccg      1440
     gcgggggtcg aagagcaggc cgcccccgaa gccgcggtat cactcgtaga aagctgccaa      1500
     aacgcaagcc gccaccgggg agaggcggtg cgggagctgt cccggctggc cggccgagtc      1560
     tcctcctttc ggctgcgcca cgacgggcag accgacattg gggagctgtt ggcgcccgtg      1620
     ctggggtga                                                              1629
//

If you have problems or comments...

PBIL Back to PBIL home page