(data stored in ACNUC30630 zone)

EMBL: FP565814.PE190

FP565814.PE190       Location/Qualifiers
FT   CDS_pept        236046..236303
FT                   /transl_table=11
FT                   /locus_tag="SRM_00190"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SRM_00190"
FT                   /db_xref="EnsemblGenomes-Tr:CBH23111"
FT                   /db_xref="UniProtKB/TrEMBL:D5H506"
FT                   /protein_id="CBH23111.1"
FT                   /translation="MPLRCVSLKWPDCREKASARAPAHLQGPPAHVHVPGTDALCGRVE
FT                   PGASLFPAAGGRDLPTAVPATAVTLTSQFHWTRPCSDHDR"
     gtgcctcttc ggtgtgtctc tctgaagtgg cctgactgcc gcgagaaagc ctctgcacga        60
     gcgcccgctc accttcaagg cccaccggct cacgtgcacg tgccggggac ggatgcgctc       120
     tgtggtcgtg ttgaaccagg ggcgtctctg tttccggcgg ctggtggccg ggacctccca       180
     acggcggtcc cggcgacggc agtcaccctg acctcccagt ttcattggac gcgtccctgc       240
     tcagaccatg accgttga                                                     258
//

If you have problems or comments...

PBIL Back to PBIL home page