(data stored in ACNUC30630 zone)

EMBL: FP565814.PE193

FP565814.PE193       Location/Qualifiers
FT   CDS_pept        complement(237780..238166)
FT                   /transl_table=11
FT                   /locus_tag="SRM_00193"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SRM_00193"
FT                   /db_xref="EnsemblGenomes-Tr:CBH23114"
FT                   /db_xref="UniProtKB/TrEMBL:D5H509"
FT                   /protein_id="CBH23114.1"
FT                   /translation="MPDYMRGSCVSLAIALHDITRWRLVKIVDEQNARRHTGGPRAPGG
FT                   PALHWAVEHPSGHLLDWEGLRGKDEVVSAYAPRAQPGTSVRWRYATREDAVDERRQTGA
FT                   CTVEEAKEDAHALADEFLPAGTAP"
     atgcccgatt acatgcgcgg ctcctgcgtt tctcttgcca tcgcgcttca cgacatcacg        60
     cggtggcggc tcgtcaagat tgtcgacgag cagaacgcgc gccggcacac cggtgggcca       120
     agggcccccg gcggcccggc cctgcactgg gccgtcgagc acccctccgg acatcttctc       180
     gactgggagg gcctgcgcgg gaaggacgaa gtcgtcagcg cctacgctcc tcgtgcccaa       240
     ccaggcacgt cggtcagatg gaggtacgcc acccgcgaag acgcggtcga cgaaaggcgt       300
     caaacgggcg cctgcacggt cgaggaggcc aaggaagacg cccatgcgct cgccgacgaa       360
     ttcttgccgg ccggaacggc accgtga                                           387
//

If you have problems or comments...

PBIL Back to PBIL home page