(data stored in ACNUC30630 zone)

EMBL: FP565814.PE204

FP565814.PE204       Location/Qualifiers
FT   CDS_pept        251167..251304
FT                   /transl_table=11
FT                   /locus_tag="SRM_00204"
FT                   /product="Hypothetical protein, membrane"
FT                   /db_xref="EnsemblGenomes-Gn:SRM_00204"
FT                   /db_xref="EnsemblGenomes-Tr:CBH23125"
FT                   /db_xref="GOA:D5H520"
FT                   /db_xref="UniProtKB/TrEMBL:D5H520"
FT                   /protein_id="CBH23125.1"
FT                   /translation="MQTARRSQTTDRPRKRHDRKRDASNFDDYMLAVVSVALVGFLIAL
FT                   "
     atgcagacag cacgccgctc tcagacgacc gaccgacctc ggaaacgcca cgaccgcaag        60
     cgggacgcgt ccaacttcga cgactacatg ctcgccgtgg tctcggtggc gctggtggga       120
     tttctcatcg cgctctag                                                     138
//

If you have problems or comments...

PBIL Back to PBIL home page