(data stored in ACNUC30630 zone)

EMBL: FP565814.PE210

FP565814.PE210       Location/Qualifiers
FT   CDS_pept        complement(259563..259898)
FT                   /transl_table=11
FT                   /locus_tag="SRM_00210"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SRM_00210"
FT                   /db_xref="EnsemblGenomes-Tr:CBH23131"
FT                   /db_xref="UniProtKB/TrEMBL:D5H526"
FT                   /protein_id="CBH23131.1"
FT                   /translation="MPRRCDTSCQRAPDRPGPRPPWSTALIQKGRSWPFGGGLLAVPTQ
FT                   TPTVTALRQQLFDFLKLAADQFDVSERVIGLFFGARQVMHGTLSPSKDLLKTVPDLSQP
FT                   PATGQDC"
     ttgccacgtc ggtgtgacac ttcctgccag agggcacctg atcgccctgg tccaagaccg        60
     ccgtggtcca ccgccctaat ccagaaaggc cgctcgtggc cttttggcgg tggccttctg       120
     gcggttccta cccagacgcc tacagttact gctctccggc agcagctctt cgattttctc       180
     aaattggccg ccgatcagtt tgacgtgtca gaacgcgtca tcgggctatt cttcggagcc       240
     agacaggtga tgcatggcac cttgtcaccc tcaaaagatc ttctcaaaac agtgcccgac       300
     ctttctcagc ccccagccac tgggcaggat tgctga                                 336
//

If you have problems or comments...

PBIL Back to PBIL home page