(data stored in ACNUC30630 zone)

EMBL: FP565814.PE211

FP565814.PE211       Location/Qualifiers
FT   CDS_pept        complement(260443..260736)
FT                   /transl_table=11
FT                   /locus_tag="SRM_00211"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SRM_00211"
FT                   /db_xref="EnsemblGenomes-Tr:CBH23132"
FT                   /db_xref="UniProtKB/TrEMBL:D5H527"
FT                   /protein_id="CBH23132.1"
FT                   /translation="MFPPGSSLMAARFLLFLSDAVFRKVLLLEYLDGVEEVQVMFLYIR
FT                   LSLPVVPVEFHRAWRNIQPVECQWIGKDSDVCTSICVHKPFPENQVLGRDSF"
     atgtttcctc caggaagcag cctgatggct gcccgtttcc ttctcttcct ctcggatgcg        60
     gtcttccgca aagtgctcct cctcgaatac ctggacggcg tcgaggaagt ccaggtcatg       120
     tttctctaca ttcgactctc ccttcccgtt gtgccagtcg aatttcatcg ggcatggcgc       180
     aacatccagc cggtcgaatg ccagtggatc ggcaaagatt ctgatgtatg cacgtcgata       240
     tgtgtgcaca agccgttccc cgagaatcag gttctcggac gagactcttt ttga             294
//

If you have problems or comments...

PBIL Back to PBIL home page