(data stored in ACNUC30630 zone)

EMBL: FP565814.PE226

FP565814.PE226       Location/Qualifiers
FT   CDS_pept        complement(277734..278222)
FT                   /transl_table=11
FT                   /locus_tag="SRM_00226"
FT                   /product="Conserved hypothetical protein containinig PIN
FT                   domain (putative nucleic acid-binding protein)"
FT                   /db_xref="EnsemblGenomes-Gn:SRM_00226"
FT                   /db_xref="EnsemblGenomes-Tr:CBH23147"
FT                   /db_xref="InterPro:IPR021799"
FT                   /db_xref="UniProtKB/TrEMBL:D5H542"
FT                   /protein_id="CBH23147.1"
FT                   /translation="MLTVSNTSPLLNLAIIGRLGLVRSQFGSVLVPPAVVKEFHLEEGR
FT                   PGSSALRQAIEGGWIVEKEPSDDPLVRTLRQDLDQGESEAIALAVEEEAGLILLDEREG
FT                   RRRARNVGLEMTGALGILAQADRRGNLDSISSALDRIESEAGFWIGPALREQILGGSE"
     gtgctgacgg taagcaatac gtctcccctc ctcaatctcg cgatcatcgg taggctgggg        60
     ctggttcgat cccagtttgg aagtgtactt gtccctccgg ccgtcgtgaa ggaatttcac       120
     ctcgaggaag ggcgccccgg ctcatctgcg ctccgccagg ccatcgaagg aggatggatt       180
     gttgagaagg agccctccga cgacccgctt gtccgcaccc tccgacaaga tttggatcag       240
     ggggagtctg aagcaattgc actcgcagtg gaagaagaag ccggtctcat cctgctcgac       300
     gagcgggaag ggcggcgccg ggcccgaaac gtcggactgg agatgaccgg cgcattgggg       360
     attctcgcac aagccgaccg ccggggaaac cttgactcga tttctagtgc cttagaccgt       420
     atcgagagcg aggccgggtt ctggattggt cctgcgctcc gcgagcagat tcttggcggt       480
     tccgaatag                                                               489
//

If you have problems or comments...

PBIL Back to PBIL home page