(data stored in ACNUC30630 zone)

EMBL: FP565814.PE229

FP565814.PE229       Location/Qualifiers
FT   CDS_pept        complement(280643..281056)
FT                   /transl_table=11
FT                   /locus_tag="SRM_00229"
FT                   /product="Conserved hypothetical protein containing PIN
FT                   domain"
FT                   /db_xref="EnsemblGenomes-Gn:SRM_00229"
FT                   /db_xref="EnsemblGenomes-Tr:CBH23150"
FT                   /db_xref="InterPro:IPR002716"
FT                   /db_xref="InterPro:IPR029060"
FT                   /db_xref="UniProtKB/TrEMBL:D5H545"
FT                   /protein_id="CBH23150.1"
FT                   /translation="MTVLLDTNVLIDAAVVSRSYHGTAVRLIAAAERDTIDGLVAPTSI
FT                   ATCWYVAHEREDTDPRPLFDLLADVMRLAPMGRSPLRKALQNPGTDDFEDSYLAAAGTS
FT                   ASASAIATRNESDFVSTTLTPYHPLDLVEMLDE"
     atgacagtcc tactcgacac gaatgtgctc atcgatgccg ccgttgtctc ccgttcctat        60
     cacggcacgg ctgtccggct gattgctgcg gccgagcgcg acaccatcga tggtctcgtc       120
     gcacccacat caatcgcgac ctgctggtac gtggcccatg agcgggaaga caccgatccg       180
     cgcccactct tcgaccttct ggcagacgtg atgcgactcg ctcccatggg acgctcaccc       240
     ctacgaaaag cgcttcagaa tcctgggacc gatgactttg aagacagtta ccttgctgct       300
     gctgggacat cagccagcgc ttctgcaatt gcaactcgaa acgagtcgga ttttgtatcg       360
     acgaccctca cgccctatca tcccctcgac ctcgtggaga tgttagacga gtag             414
//

If you have problems or comments...

PBIL Back to PBIL home page