(data stored in ACNUC30630 zone)

EMBL: FP565814.PE238

FP565814.PE238       Location/Qualifiers
FT   CDS_pept        286055..286441
FT                   /transl_table=11
FT                   /locus_tag="SRM_00238"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SRM_00238"
FT                   /db_xref="EnsemblGenomes-Tr:CBH23159"
FT                   /db_xref="UniProtKB/TrEMBL:D5H554"
FT                   /protein_id="CBH23159.1"
FT                   /translation="MSSGRAIPYKREGGSVTVAPACSPETGGLWTGHSQNGLSYRCKSC
FT                   VFLRASPSRNGRSENMEQTRRDGRFSLSKSIGVICAPNTSAVPTGNRREKIAELARKGR
FT                   TPKELAEEFELTQTITVGWLKQAD"
     ttgtcttcag gccgggctat tccctacaag agggagggag gcagcgttac agtcgcccct        60
     gcctgcagcc cggaaactgg aggcctctgg actggtcatt ctcagaacgg cttgtcctat       120
     aggtgtaaga gttgcgtatt cttgcgtgca agcccaagca gaaacggcag gagcgaaaat       180
     atggagcaaa cccggcgcga tgggcgtttt tcactttcca aatcgatagg tgtcatctgt       240
     gccccgaaca cgtccgcggt acccactgga aaccggagag aaaagatcgc cgaacttgcc       300
     cggaaggggc gaacgcccaa agaactggct gaagagttcg agctgaccca gacgataacc       360
     gtgggttggc tgaagcaagc tgattga                                           387
//

If you have problems or comments...

PBIL Back to PBIL home page