(data stored in ACNUC30630 zone)

EMBL: FP565814.PE250

FP565814.PE250       Location/Qualifiers
FT   CDS_pept        297089..297301
FT                   /transl_table=11
FT                   /locus_tag="SRM_00250"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SRM_00250"
FT                   /db_xref="EnsemblGenomes-Tr:CBH23171"
FT                   /db_xref="UniProtKB/TrEMBL:D5H566"
FT                   /protein_id="CBH23171.1"
FT                   /translation="MRIAVRSLLETVACLHLINRRDYLDDLGPLREAYHDSETLFAKLQ
FT                   AFRASLDTDSSVREPSVEYDDEAPF"
     ctgcgaatcg ccgtccggtc gctgctcgaa accgttgcct gtcttcacct gatcaaccgc        60
     cgtgactacc tcgacgacct gggaccgctg cgcgaggcgt accacgacag cgagacgcta       120
     tttgccaaac tgcaggcgtt tcgcgcctcc ctggataccg actcctccgt tcgagagccg       180
     tcagtcgaat atgacgacga ggctccattt tag                                    213
//

If you have problems or comments...

PBIL Back to PBIL home page