(data stored in ACNUC30630 zone)

EMBL: FP565814.PE272

FP565814.PE272       Location/Qualifiers
FT   CDS_pept        complement(325872..326117)
FT                   /transl_table=11
FT                   /locus_tag="SRM_00272"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SRM_00272"
FT                   /db_xref="EnsemblGenomes-Tr:CBH23193"
FT                   /db_xref="UniProtKB/TrEMBL:D5H588"
FT                   /protein_id="CBH23193.1"
FT                   /translation="MLAQAAFKISFESVRNSKPSKCFGFHSSAFFLNDAERTLAFVASF
FT                   LVHIINVGRIDSGGKFSHRSMRCKLGSLVIHGAPAM"
     ctgctcgcac aggcggcttt caagatcagc tttgagtccg ttagaaactc aaaaccaagc        60
     aagtgctttg gattccactc gtcagccttc ttccttaacg acgctgaacg aaccctggcc       120
     ttcgtcgcca gtttcctcgt tcacatcatc aatgttggaa ggattgatag tggcggtaag       180
     ttcagtcacc gatccatgcg gtgtaagctc gggagtttgg taatccatgg tgcgcctgcg       240
     atgtaa                                                                  246
//

If you have problems or comments...

PBIL Back to PBIL home page