(data stored in ACNUC30630 zone)

EMBL: FP565814.PE274

FP565814.PE274       Location/Qualifiers
FT   CDS_pept        329016..329309
FT                   /transl_table=11
FT                   /locus_tag="SRM_00274"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SRM_00274"
FT                   /db_xref="EnsemblGenomes-Tr:CBH23195"
FT                   /db_xref="InterPro:IPR008792"
FT                   /db_xref="InterPro:IPR041881"
FT                   /db_xref="UniProtKB/TrEMBL:D5H590"
FT                   /protein_id="CBH23195.1"
FT                   /translation="MASLDDSIAATDSFASAEVDDERILLDPETGTYYGLNPVGDHVLR
FT                   MVEDADTERVSIRSVVDALHDTFPDEDYDRLSEDVLTFVDEMEDFDLLLVHD"
     atggcttccc ttgacgactc catcgcggca acggattcat ttgcgagcgc cgaggtggac        60
     gacgagcgca ttctcttgga tcccgaaacg ggaacgtact acggcctgaa tccggtcggc       120
     gaccatgtgc tccgcatggt ggaggacgcg gacacggaac gcgtctcgat ccgcagcgtc       180
     gtggatgccc tgcacgacac ctttccggac gaggactacg accgtctctc cgaagacgtg       240
     ctcacgttcg tcgacgagat ggaggacttt gaccttctcc tcgtgcacga ctga             294
//

If you have problems or comments...

PBIL Back to PBIL home page