(data stored in ACNUC30630 zone)

EMBL: FP565814.PE279

FP565814.PE279       Location/Qualifiers
FT   CDS_pept        complement(334445..334630)
FT                   /transl_table=11
FT                   /locus_tag="SRM_00279"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SRM_00279"
FT                   /db_xref="EnsemblGenomes-Tr:CBH23200"
FT                   /db_xref="UniProtKB/TrEMBL:D5H595"
FT                   /protein_id="CBH23200.1"
FT                   /translation="MVTRFTKLRVYFRSETQVDHGLKALDMSEGPAPSGFTELPLMVGL
FT                   EPVDLQLLHGGKSSAT"
     atggtgacac ggttcaccaa acttcgggtt tactttcgat cggagactca agtagaccac        60
     gggctcaaag cattggacat gagcgaagga ccagccccct ccggctttac cgaactgccg       120
     ctcatggtgg gacttgaacc tgttgacctc cagctccttc acggcgggaa gtcgagtgcg       180
     acgtga                                                                  186
//

If you have problems or comments...

PBIL Back to PBIL home page