(data stored in ACNUC30630 zone)

EMBL: FP565814.PE281

FP565814.PE281       Location/Qualifiers
FT   CDS_pept        335212..336072
FT                   /transl_table=11
FT                   /locus_tag="SRM_00280"
FT                   /product="Hypothetical protein, secreted"
FT                   /db_xref="EnsemblGenomes-Gn:SRM_00280"
FT                   /db_xref="EnsemblGenomes-Tr:CBH23201"
FT                   /db_xref="GOA:D5H596"
FT                   /db_xref="UniProtKB/TrEMBL:D5H596"
FT                   /protein_id="CBH23201.1"
FT                   /translation="MQLKARLRGRKNASRRRDRRGSCSCCPTTISTAFVCTPLVGPLRF
FT                   ESNCGGFCATRAPNQPGRTLGATFGSRLTYGRRSNRHRTRRDTSARAPGVGSRSGTPRS
FT                   GQGKTTIALSLLRHGWAALSDDTVLLCATGNGVRAHAFRRPLCVDPGAANRFPELDGPG
FT                   WPASLSDASKWQVDIDRLYPGQSESTSTPRLLVLPTIADAPTSRIEPIGAKPALEQLLA
FT                   QSAFFLSSRPEVADRHLSVLRRLVDQTRTHRLHSGRDVLNEPHTAHALLAPLLTGGPAP
FT                   NAVSG"
     ctgcaattaa aagcacggct ccggggacga aaaaacgcat ctcgtcgtag ggaccgcaga        60
     ggctcgtgct catgttgccc aactaccatc tccacggcct tcgtctgcac gccgctggtg       120
     ggacccctgc ggttcgaaag caactgcggc ggattctgcg ctacaagggc gccgaaccaa       180
     ccggggcgga cactgggggc gacattcggc tcacgcttga cgtacggacg ccgctcgaat       240
     cgccaccgga cacggcgcga cacgtcggca cgagcgcccg gtgtgggatc gaggtctgga       300
     acgccccgga gcgggcaggg caagacgaca attgccttga gcctgctccg ccacgggtgg       360
     gcggccctgt ccgacgacac ggtgttgctt tgtgccacag gcaacggagt gagggcgcac       420
     gcctttcggc ggcccctctg tgtggatccg ggcgcggcca atcgttttcc cgagctggac       480
     gggcccggct ggcccgcgtc cctcagcgac gcgtcgaagt ggcaggtcga cattgaccgc       540
     ctgtaccccg gacagtccga atcgaccagc acaccccgcc tgcttgtcct gcccacgatt       600
     gccgacgcgc cgacgagccg cattgagccg atcggggcca agcccgccct ggagcagctc       660
     ctcgcccaga gcgcgttttt cctgtcgtcg cgtcctgagg ttgccgaccg gcacctgtcc       720
     gtgctccgtc ggctcgtcga ccagacccga acccatcgcc tccattccgg ccgcgacgtg       780
     ctgaacgagc cgcacacggc gcatgcgctt ctggccccgc tgctgacggg cggcccggcc       840
     cccaacgccg tctccgggta a                                                 861
//

If you have problems or comments...

PBIL Back to PBIL home page