(data stored in ACNUC30630 zone)

EMBL: FP565814.PE290

FP565814.PE290       Location/Qualifiers
FT   CDS_pept        348847..349620
FT                   /transl_table=11
FT                   /locus_tag="SRM_00290"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SRM_00290"
FT                   /db_xref="EnsemblGenomes-Tr:CBH23211"
FT                   /db_xref="UniProtKB/TrEMBL:D5H5A6"
FT                   /protein_id="CBH23211.1"
FT                   /translation="MCRPMNTPTENDESSTPPNGGGPNGSSNKSDLEKENDSGKERSPR
FT                   EQGAGPGAKEVASGAGGLAAEREVTSREWRRLRAPFSREAYVVGSRATGRTAANLPLGA
FT                   YSEESQPNESQSGSGGGSPNETRNQAVVDLWLRAEAIRDRLDLVLGPGRYGYRLEAGPE
FT                   AGGTFSMRCHLRIGPGRRTGIGTGRSLQQAGKVALASAAEAFGMGASGKIAGPLVADSE
FT                   SWHQLPGPVLERLERREELSSWAPGSSGSEDKGQA"
     atgtgtagac caatgaacac cccaaccgaa aatgacgaaa gctctactcc cccaaacggc        60
     ggtggcccaa atggtagctc gaataagagt gacttggaga aagaaaatga ttcgggaaaa       120
     gaacggagcc cgagagaaca aggcgcgggc ccgggcgcca aggaagtcgc ttcgggagct       180
     gggggccttg cggcagagcg cgaggttacc tcaagagagt ggcgccgcct gcgcgctcct       240
     ttctcccgag aagcttatgt cgtgggcagt cgggcgaccg gccggaccgc ggcgaacctt       300
     ccgttggggg catactccga ggaatcacag cccaacgaat cccaatctgg aagtggcggc       360
     gggagcccca acgagacccg gaatcaggcg gtcgtcgacc tatggctccg ggcagaagca       420
     atccgcgacc ggctcgacct ggtcctaggg cctgggcgct acggctaccg cctggaggcg       480
     gggccggagg caggcggtac cttttcgatg cgctgccatc tccggatcgg gcccgggcgg       540
     cgaactggca tcggaaccgg ccggagcctc cagcaggccg gaaaggtcgc gctagcaagt       600
     gcggcggagg ccttcggaat gggtgcctcc gggaagatcg ccgggccgct cgtggccgac       660
     agtgagagtt ggcaccagct gcccggcccg gtgctcgagc ggctcgagcg ccgagaagag       720
     ctgtcctcgt gggcgccggg ctcttctggg tctgaagaca aaggacaggc ttga             774
//

If you have problems or comments...

PBIL Back to PBIL home page