(data stored in ACNUC30630 zone)

EMBL: FP565814.PE294

FP565814.PE294       Location/Qualifiers
FT   CDS_pept        353089..353670
FT                   /transl_table=11
FT                   /locus_tag="SRM_00294"
FT                   /product="Conserved hypothetical protein, containing PIN
FT                   domain"
FT                   /db_xref="EnsemblGenomes-Gn:SRM_00294"
FT                   /db_xref="EnsemblGenomes-Tr:CBH23215"
FT                   /db_xref="InterPro:IPR002716"
FT                   /db_xref="InterPro:IPR029060"
FT                   /db_xref="UniProtKB/TrEMBL:D5H5B0"
FT                   /protein_id="CBH23215.1"
FT                   /translation="MATGCFSAAQERISQPSTACWTVRDKNPSPLGRWTMQSERPSAKA
FT                   PAPPEPELRQRQRTTMTGIDTNVLVRYITRDHPEQYKAAKRHLESNCTQEDPGYVNVIV
FT                   LCELAWVLTTAYDAASEEVARVIDQLLRTRQLQIQCRDQVRSALAEHRDGRAGFPDCLI
FT                   GHLNREEGAGETVTFDQDAAQMGRWRELEW"
     atggcgaccg ggtgcttctc cgccgcgcag gagcggatct ctcagccctc gacggcatgt        60
     tggaccgttc gggacaagaa cccgtctcca ctggggagat ggacaatgca atcggaacgg       120
     ccatcagcga aggccccagc gcctccagaa ccggaattga ggcaaagaca gaggacgacc       180
     atgaccggaa ttgacacgaa cgtcctcgtt cggtacatca ctcgggacca tcccgagcag       240
     tacaaggccg cgaaacgaca ccttgagtcc aactgcacgc aggaggaccc cggctacgtg       300
     aacgtgattg tcctctgcga gcttgcctgg gtactcacga ccgcatacga cgcagcatca       360
     gaggaagtcg ctcgggttat cgatcaactg ctccggaccc gccagctaca gatacagtgc       420
     cgggatcagg ttcgctcggc actcgctgaa cacagagatg gtagggccgg ctttccggac       480
     tgcctgattg gccacctcaa ccgggaggag ggggccggcg agacggtgac cttcgatcag       540
     gacgccgccc agatgggccg gtggcgtgag ctggaatggt ga                          582
//

If you have problems or comments...

PBIL Back to PBIL home page