(data stored in ACNUC30630 zone)

EMBL: FP565814.PE308

FP565814.PE308       Location/Qualifiers
FT   CDS_pept        366803..367333
FT                   /transl_table=11
FT                   /locus_tag="SRM_00308"
FT                   /product="Hypothetical protein, secreted"
FT                   /db_xref="EnsemblGenomes-Gn:SRM_00308"
FT                   /db_xref="EnsemblGenomes-Tr:CBH23229"
FT                   /db_xref="UniProtKB/TrEMBL:D5H5C4"
FT                   /protein_id="CBH23229.1"
FT                   /translation="MSKDSSYAQLCVIMKWGFRYRFAFLVGLVALSFAGGAFAQSSDQP
FT                   EPVPRELAAAPIGSGFGGESTDFFVGTLPSGLPDDFTLPEDAQVLGGGVDRWLWVPTES
FT                   FWVVLTAGAADHRCGRPLAVQFREGEARQYACRSGMEPNDFCALKSASLPATPVFLYSP
FT                   VLPRGHGPPSLYI"
     ttgagcaaag attcctcata cgcgcaatta tgcgtaatta tgaagtgggg tttccgatat        60
     cggttcgctt ttctcgtggg acttgtcgcg ctctcgttcg caggaggtgc gtttgcacag       120
     agcagcgatc agcccgagcc tgtgccaaga gaattggccg ctgcgccgat cggctctggt       180
     ttcgggggag agtctacgga ctttttcgtc ggaacgctcc cgagcggtct ccccgatgac       240
     ttcacgctcc cggaggacgc gcaggttctg ggaggggggg tcgacagatg gctttgggtt       300
     cccacggaat ccttttgggt cgtcctcacc gccggagcgg cggatcatcg ttgcggacgt       360
     ccccttgcgg tccagttccg tgaaggcgag gcacgacagt acgcttgtcg gtcggggatg       420
     gagccgaatg acttctgtgc cctcaaatca gcaagtcttc cagcgacgcc agtcttcctc       480
     tacagccctg ttttgccgcg aggacacggt cctccgtcgc tttatatcta g                531
//

If you have problems or comments...

PBIL Back to PBIL home page