(data stored in ACNUC30630 zone)

EMBL: FP565814.PE326

FP565814.PE326       Location/Qualifiers
FT   CDS_pept        385884..386198
FT                   /transl_table=11
FT                   /locus_tag="SRM_00326"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SRM_00326"
FT                   /db_xref="EnsemblGenomes-Tr:CBH23247"
FT                   /db_xref="UniProtKB/TrEMBL:D5H5E2"
FT                   /protein_id="CBH23247.1"
FT                   /translation="MPAFLRQPPSRSDDAHRAALPDDGLSRSQYNRRLHRVQPLLEALF
FT                   DWLGRLHKTASRENVFLIDSCPIPACDNIRIRDCRIYPSEAIEDVFGDITAANTGGSMG
FT                   "
     ctgcccgctt ttttgcggca acctccgagc cgctcagacg atgctcatcg agcagcgcta        60
     cctgacgatg ggctcagccg gagccagtac aaccggcgcc tgcaccgggt tcagccgctt       120
     ctggaggcac tcttcgattg gctcggtcga ctgcacaaga cggcctctcg tgagaatgta       180
     tttctgatcg atagctgccc gattccagcc tgcgataata tccgcatccg ggactgccgc       240
     atctaccctt cagaagcgat agaggacgtt ttcggggata tcacagcagc aaacaccggt       300
     ggttctatgg gctga                                                        315
//

If you have problems or comments...

PBIL Back to PBIL home page