(data stored in ACNUC30630 zone)

EMBL: FP565814.PE332

FP565814.PE332       Location/Qualifiers
FT   CDS_pept        392444..392572
FT                   /transl_table=11
FT                   /locus_tag="SRM_00332"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SRM_00332"
FT                   /db_xref="EnsemblGenomes-Tr:CBH23253"
FT                   /db_xref="GOA:D5H5E8"
FT                   /db_xref="UniProtKB/TrEMBL:D5H5E8"
FT                   /protein_id="CBH23253.1"
FT                   /translation="MLAESRAHWANALFLSAIAASEWIVFPAAFSGLPVPFSAAAL"
     atgctggcag aaagccgagc ccactgggcc aacgcccttt tcctcagcgc catcgcggcc        60
     tccgaatgga tcgttttccc ggcggcattt tcaggccttc cggttccctt ctctgccgcc       120
     gcgctctga                                                               129
//

If you have problems or comments...

PBIL Back to PBIL home page