(data stored in ACNUC30630 zone)

EMBL: FP565814.PE333

FP565814.PE333       Location/Qualifiers
FT   CDS_pept        392725..392913
FT                   /transl_table=11
FT                   /locus_tag="SRM_00333"
FT                   /product="Hypothetical protein, membrane"
FT                   /db_xref="EnsemblGenomes-Gn:SRM_00333"
FT                   /db_xref="EnsemblGenomes-Tr:CBH23254"
FT                   /db_xref="GOA:D5H5E9"
FT                   /db_xref="UniProtKB/TrEMBL:D5H5E9"
FT                   /protein_id="CBH23254.1"
FT                   /translation="MLIWMVADAFLVGVAGMEEIEEDLALVAVLLGPLLAAAADGGLAI
FT                   YFLFIRAQEEVVRLREG"
     gtgctgatct ggatggtggc agatgccttc cttgttggtg tggcgggcat ggaagaaatt        60
     gaggaagacc tagcgcttgt ggccgtgctc ctaggtcctc ttctcgccgc tgccgcagat       120
     ggaggactgg caatctactt cctgttcatt cgggcgcagg aggaggttgt caggctgagg       180
     gaaggctga                                                               189
//

If you have problems or comments...

PBIL Back to PBIL home page