(data stored in ACNUC30630 zone)

EMBL: FP565814.PE339

FP565814.PE339       Location/Qualifiers
FT   CDS_pept        complement(396921..397850)
FT                   /transl_table=11
FT                   /locus_tag="SRM_00339"
FT                   /product="Conserved hypothetical protein, membrane"
FT                   /db_xref="EnsemblGenomes-Gn:SRM_00339"
FT                   /db_xref="EnsemblGenomes-Tr:CBH23260"
FT                   /db_xref="UniProtKB/TrEMBL:D5H5F5"
FT                   /protein_id="CBH23260.1"
FT                   /translation="MPHTLVSRGIRPLVLAGILLCGLAPSGIVAAPLPAEPGQSATSGP
FT                   ALSNDRPLPMHIDPMCTRPARPAASPALCPRPMDLLQAGATRAVPAPRQSLAAFRRPPV
FT                   RRDVPLRQIVLRQRVSRQRMQGPERPALELGDSQAGRALWGSVIGTAVGWALGGVLLAG
FT                   ADEVEAPPQSAGGNQSTPEGVALLLLAGGPPAGAIINTDVEWGNAKAWALGVLGGAVLG
FT                   GAGIALGTAIGGSDRGEAVGALVLGAPGAAVGGGVGVLLAAPDGRSALRYSAESGTWSA
FT                   GLPAVRMRPGAGPEADLVGKVSLVTVDL"
     atgccccata cgctcgtgtc gcgagggatc cgcccactcg tcttggcggg gatcttactc        60
     tgtggcctcg ccccgtccgg gatcgtggcc gctcccctac cggcagaacc cgggcagtcg       120
     gccacgagcg gcccggccct ttccaacgac cgccccctcc cgatgcatat agatccgatg       180
     tgcacccgac cggcaaggcc ggcggccagt cccgcgctgt gtccgaggcc catggacctg       240
     ctccaggccg gtgccacacg cgcggttcct gcgcctcgcc agtcgttggc tgcgtttcgg       300
     cggcccccgg ttcgacgcga cgtcccgttg cgtcaaatcg tattgcgtca acgcgtatca       360
     cgtcaacgca tgcaaggacc cgagcgaccg gcattggagc tgggggactc gcaggccggc       420
     agggccctct ggggaagcgt gatcggaacc gccgtgggct gggccttggg aggggttctg       480
     ctcgctgggg ccgacgaggt tgaggcgccg cctcagtctg ctgggggcaa ccagtccacg       540
     cccgaagggg tcgcactgct tcttctcgcc ggagggccgc ccgcgggcgc aatcatcaac       600
     acggatgtcg agtggggaaa tgcgaaggct tgggcgctgg gcgtgcttgg gggagcggtc       660
     ctgggcgggg ccggaatcgc gttggggacc gcaatcggcg ggtccgatcg aggggaggcg       720
     gtcggcgcac tggtgctcgg cgcgccgggc gcggcagtcg gagggggcgt gggcgttctg       780
     ctggcggcgc ccgatggccg gagcgcgctg cgctacagcg ccgaatccgg cacgtggagc       840
     gcgggcctgc cggccgtccg gatgcgtccg ggagcaggcc ctgaggccga cctggtgggg       900
     aaggtctcac tggtgacggt ggacttgtaa                                        930
//

If you have problems or comments...

PBIL Back to PBIL home page