(data stored in ACNUC30630 zone)

EMBL: FP565814.PE346

FP565814.PE346       Location/Qualifiers
FT   CDS_pept        408251..409765
FT                   /transl_table=11
FT                   /locus_tag="SRM_00346"
FT                   /product="Conserved hypothetical protein, secreted"
FT                   /db_xref="EnsemblGenomes-Gn:SRM_00346"
FT                   /db_xref="EnsemblGenomes-Tr:CBH23267"
FT                   /db_xref="GOA:D5H5G2"
FT                   /db_xref="InterPro:IPR004843"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR019546"
FT                   /db_xref="InterPro:IPR029052"
FT                   /db_xref="InterPro:IPR032285"
FT                   /db_xref="InterPro:IPR032288"
FT                   /db_xref="UniProtKB/TrEMBL:D5H5G2"
FT                   /protein_id="CBH23267.1"
FT                   /translation="MSQTRRDFLKYLSLTGAALGVPGVATGAPHLSAGRESVAVTGRVT
FT                   GPDGGLEGVPVTDGVAVTQTGPDGRYELAASPRRPFVYLSVPSGYRLPTHETGTARFYR
FT                   PLGAAGGGTAEASFRLTPLDRDDEQHAFLFLADPQTRTAAEMRQFRDETVPDVQEAVRA
FT                   LGNRPVFGVGGGDLVFDELSLFSGYEAAVEEMGIPFVQAVGNHDLDFDAPGDPGSTATF
FT                   RQHFGPEYYSFDRGTVHYVVLDDVYWPGSDGFGRETGDYHGHLDAAQLAWLEQDLALVE
FT                   DGRPVVVFTHIPPLSTAYERRGEDSPSVRGRIGNRAALYELLDPFDAHIVSGHVHENEH
FT                   RFADGPHEHVVGTVCGAWWTGPVCYDGTPKGYAVYEVDGDSIAWRYKATGRAADHQVRA
FT                   YPSGADPEAPGEWVANVWDATDDWTVVWYEDGIRTGAMARRVGLDPMSRRRHEGDNQPE
FT                   KHTWVEPQPTAHLYYAPANPDANRVRVEATDPFGRTYVARPSSNRG"
     atgtctcaga cccgccgcga cttcttgaag tatctcagcc tcaccggggc cgccctcggc        60
     gtcccgggcg tggccacggg agcgccgcac ctgagcgccg gccgtgagtc ggttgccgtc       120
     accggccgcg tgacggggcc ggatgggggg ctggagggcg tgcctgtcac cgacggcgtc       180
     gccgtcacgc agaccggccc cgacgggcgc tatgagctgg ccgcctcgcc ccgccggccg       240
     tttgtctacc tctcggtgcc gagcgggtac cgcctcccga cccacgagac gggcaccgcc       300
     cggttctacc ggcctctggg cgcggcgggc ggcggcacgg cggaggcgtc gtttcggctc       360
     acgcccctcg accgcgacga cgagcagcac gcgttcctct tcctggccga tccgcagacc       420
     cggacggcgg cggaaatgcg gcaattccgg gacgagacgg tgccggacgt gcaggaggcc       480
     gtgcgggcgc tcgggaaccg tcccgtcttc ggcgtaggcg ggggcgacct cgtgttcgac       540
     gagctgtcgc tcttttccgg ctacgaggcg gcggttgagg agatgggcat cccgttcgta       600
     caggcggtgg gcaaccacga cctcgacttc gacgcgccgg gcgatccggg ctccacggcc       660
     accttccggc agcacttcgg ccccgagtac tactcgttcg accgggggac cgtccactac       720
     gtcgtgctcg acgacgtgta ctggccgggg agcgacggct ttggacgaga gaccggtgac       780
     taccacggcc acctcgacgc cgcccagctt gcgtggctgg agcaggacct cgcgctcgtg       840
     gaggacggcc ggcccgtcgt cgtgttcacg cacatcccgc ccctcagtac cgcctacgag       900
     cggcgcggcg aggacagccc gtcggtccgg ggccgaatcg gaaaccgggc cgcgctctac       960
     gaactgctcg atccgttcga cgcccacatc gtcagcgggc acgtccacga aaacgagcac      1020
     cgctttgccg acgggccgca cgagcacgtg gtgggcacgg tgtgcggcgc gtggtggacc      1080
     gggccggtct gctacgacgg cacgcccaag ggctacgcgg tctacgaggt ggacggggac      1140
     tccatcgcgt ggcgctacaa ggccaccggc cgcgccgccg accaccaggt gcgggcgtac      1200
     ccgtccgggg ccgaccccga ggcgccgggc gagtgggtgg ccaacgtctg ggacgccacc      1260
     gacgactgga cggtggtgtg gtacgaggac ggcatccgca ccggcgccat ggcccgccgc      1320
     gtgggcctcg atccgatgag ccggcgccgc cacgaagggg acaaccagcc ggagaagcac      1380
     acgtgggtgg agccccagcc caccgcccat ctgtactacg cgcccgccaa ccccgacgcg      1440
     aatcgggtgc gcgtggaggc caccgatccc ttcgggcgca cctacgtggc ccgcccttcc      1500
     tcaaataggg gatga                                                       1515
//

If you have problems or comments...

PBIL Back to PBIL home page