(data stored in ACNUC30630 zone)

EMBL: FP565814.PE355

FP565814.PE355       Location/Qualifiers
FT   CDS_pept        complement(419947..420330)
FT                   /transl_table=11
FT                   /locus_tag="SRM_00355"
FT                   /product="Conserved hypothetical protein, membrane"
FT                   /db_xref="EnsemblGenomes-Gn:SRM_00355"
FT                   /db_xref="EnsemblGenomes-Tr:CBH23276"
FT                   /db_xref="GOA:D5H5H1"
FT                   /db_xref="UniProtKB/TrEMBL:D5H5H1"
FT                   /protein_id="CBH23276.1"
FT                   /translation="MNIVLAAGVVVGFAVIIERLRLPGHARQVGRHSTTCLRVLRDDSL
FT                   DDAAKETALQNRARELFGLLGRLVGGSALALGLPLGGVWLLGRAGVGSFSGTFATLQRI
FT                   DFLAVTTAVGLLAYVLVQRTRAS"
     atgaacattg tcctcgccgc cggcgtcgtg gtcggctttg ccgtcatcat cgaacgcctt        60
     cgccttcccg ggcacgcccg ccaggtgggg cggcacagca ccacctgtct tcgggtgctt       120
     cgggacgact ccctggatga cgcggcgaag gaaacggccc tgcagaatcg cgcccgggag       180
     cttttcgggc tcctgggtcg actggtgggg ggaagtgccc tcgcactggg gcttcctctg       240
     gggggcgtct ggcttcttgg ccgtgcgggc gtcggctcat ttagcggcac cttcgccacg       300
     cttcagcgca ttgattttct cgccgtgacg acggcggtcg gcctgctcgc atacgtcctc       360
     gttcaacgca cccgtgcatc atga                                              384
//

If you have problems or comments...

PBIL Back to PBIL home page