(data stored in ACNUC30630 zone)

EMBL: FP565814.PE368

FP565814.PE368       Location/Qualifiers
FT   CDS_pept        complement(432520..432666)
FT                   /transl_table=11
FT                   /locus_tag="SRM_00368"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SRM_00368"
FT                   /db_xref="EnsemblGenomes-Tr:CBH23289"
FT                   /db_xref="GOA:D5H5I4"
FT                   /db_xref="InterPro:IPR018967"
FT                   /db_xref="InterPro:IPR042216"
FT                   /db_xref="UniProtKB/TrEMBL:D5H5I4"
FT                   /protein_id="CBH23289.1"
FT                   /translation="MMDTDGCPHEGDGETLLADTRMALCRCGASESKPFCDEGHTEVGF
FT                   EAG"
     gtgatggaca ccgacggctg cccccacgag ggcgacggcg agacgctcct cgccgataca        60
     cggatggccc tctgccgctg cggcgcttcc gaaagcaagc ccttctgtga cgaaggccac       120
     acggaggtgg gcttcgaagc gggttga                                           147
//

If you have problems or comments...

PBIL Back to PBIL home page