(data stored in ACNUC30630 zone)

EMBL: FP565814.PE376

FP565814.PE376       Location/Qualifiers
FT   CDS_pept        complement(444277..444423)
FT                   /transl_table=11
FT                   /locus_tag="SRM_00376"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SRM_00376"
FT                   /db_xref="EnsemblGenomes-Tr:CBH23297"
FT                   /db_xref="UniProtKB/TrEMBL:D5H5J2"
FT                   /protein_id="CBH23297.1"
FT                   /translation="MTAVYYCYCFTAKTLPQRRCVEVVRERSFVNSSIRVRLVCGTVES
FT                   HGA"
     atgaccgctg tttattactg ttattgtttc accgcgaaaa cccttcctca gcgccgatgc        60
     gtggaggtcg tgcgggaacg cagctttgtg aattcctcga ttcgtgtgcg cctcgtctgt       120
     ggtaccgtgg aatctcacgg agcctga                                           147
//

If you have problems or comments...

PBIL Back to PBIL home page