(data stored in ACNUC30630 zone)

EMBL: FP565814.PE4

FP565814.PE4         Location/Qualifiers
FT   CDS_pept        3396..3527
FT                   /transl_table=11
FT                   /locus_tag="SRM_00004"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SRM_00004"
FT                   /db_xref="EnsemblGenomes-Tr:CBH22925"
FT                   /db_xref="UniProtKB/TrEMBL:D5H4H0"
FT                   /protein_id="CBH22925.1"
FT                   /translation="MSYRGNNPNVEMRAFSKIESASRYRSSAADEASGAALRILALA"
     gtgtcgtacc ggggaaacaa ccccaacgtg gagatgcgtg ccttttctaa aatcgagagt        60
     gcctccaggt accgctcgtc ggccgccgac gaagcctccg gcgccgcgct gcgcatcctc       120
     gcactggcgt ag                                                           132
//

If you have problems or comments...

PBIL Back to PBIL home page