(data stored in ACNUC30630 zone)

EMBL: FP565814.PE428

FP565814.PE428       Location/Qualifiers
FT   CDS_pept        complement(512810..515728)
FT                   /transl_table=11
FT                   /locus_tag="SRM_00428"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SRM_00428"
FT                   /db_xref="EnsemblGenomes-Tr:CBH23349"
FT                   /db_xref="GOA:D5H5P4"
FT                   /db_xref="InterPro:IPR024079"
FT                   /db_xref="InterPro:IPR032534"
FT                   /db_xref="InterPro:IPR033413"
FT                   /db_xref="InterPro:IPR034032"
FT                   /db_xref="UniProtKB/TrEMBL:D5H5P4"
FT                   /protein_id="CBH23349.1"
FT                   /translation="MRAAPYERRAGLPHRSGREDAVVQWMRPPRSHALTSMRRFLFLVL
FT                   APLLLAACTTVNVRPDDAADEPGGPSTEAAPPTDDDGTAGADDGEDDPFEPWGETLEGT
FT                   RKVDGFLPLHEKDDGTLYAEIPSERMGDPFGLTLHVSQGVGVFNLHDGLPLSDTRLMEF
FT                   RRVNRSVHLVHRNVRFRADAGPMRTSLNENTGDSVVEAFDIVSRNDSTGHLLIEVSDFL
FT                   TSDYPEIGDRLSLYFGGAPASLQGGKSYVKKARGFPANTEIDVSLTYQGSSAPLIGGEA
FT                   VPDYRAVPVGVRYSLFALPESKMQRRRADDRVGYFVDAVKDFSRDQASTPYVRYVQRWR
FT                   LAPSDTAAYKRGELVEPAEPIVYYVDRTVPDRYREYVKQGIEAWNEAYRAAGYKNAVEA
FT                   RVAPDDSTWSAEDIRYSTVRWTAAHQMGYAIGPSQTDPRTGEILNADILISSSFVRGWQ
FT                   DTYSQITPGPSADTGALAQGPVSSRTPKALRKMLSPELARQACWAERGMAQQIGLQRTL
FT                   LLARGAIAPGESMPEKYLGAAIKDLVMHEVGHTLGLRHNFKASSGIPNDELHDESYTEE
FT                   HGVSLSVMDYAPVNVALDEEEQGHYWNPTVGPYDEWAIKYGYMPIAEQSDDGALTRNGP
FT                   LADTATAATAGLHKIAATSSDPTHRYGTDEDTWLGGYAVDPLTNAWELGSDPMAFAETR
FT                   AALVKTVMPKLEDRLVSAGERYYPLRRATTALLMERYRSLRPVTKTVGGSYVARDHKGT
FT                   PDARPPLRPVPAEEQREAVQLLVDEAFAPDAFEFDPERLNKLAPNRRSHWGTSPSLPLD
FT                   YPVHRRVHTIQRNLLRELLHPARLQRMIDAQARTPDGAGYAPGALFRTMTDAIWSELDT
FT                   AGPQPAPINSFRRPLQRTYADMLIELMMGTTSWITITTAGIDQIDAPEDVRSVARLELT
FT                   ELSDQIETALGTPGLKRETRAHLSETQARIDRALNASLDLSP"
     gtgcgggccg ccccctacga gcggcgcgcc ggcctccccc accggtccgg acgggaggac        60
     gccgtcgtcc agtggatgcg gcctccccgc tcccacgctt tgacgtctat gcgcagattc       120
     ctctttcttg ttctcgcccc cctccttctc gccgcatgca cgacggtgaa cgttcgcccg       180
     gatgacgcgg ccgacgagcc gggcgggccc tcgacagagg ccgccccgcc caccgacgac       240
     gacgggacgg caggggcgga cgatggcgag gacgacccat tcgagccctg gggcgagacg       300
     ctcgagggca cccgaaaagt cgacgggttt ctgcccctgc acgagaaaga cgacgggacg       360
     ctctacgccg agattccgtc ggaacggatg ggcgacccgt tcgggctcac cctccacgtc       420
     agccagggcg taggggtctt caacctacac gacgggctgc ccctcagcga cacgcgcctg       480
     atggagttcc gccgtgtgaa ccgctccgta cacctcgttc accgcaacgt tcgcttccgg       540
     gcggatgcgg gcccgatgcg cacgtccctg aacgaaaaca ccggggactc cgtggtcgag       600
     gccttcgaca tcgtcagccg caacgactcg accggacacc tgctgattga ggtgtccgac       660
     ttcctgacat cggactaccc cgagatcggc gaccggctca gcctgtactt tggcggggcc       720
     ccggcctccc ttcagggcgg aaagagctac gtgaagaagg cccggggctt tcccgccaac       780
     acggagatcg acgtatcgct tacctatcag ggctcgtccg ccccgctcat cggaggcgag       840
     gccgtccccg actaccgggc cgtgcccgtg ggcgtgcggt actccctgtt tgcactcccg       900
     gagtccaaaa tgcagcgacg ccgcgccgac gaccgggtgg gctacttcgt cgacgcggtg       960
     aaggactttt ctcgggacca ggcgtccacc ccctacgtcc gctacgtgca gcggtggcgc      1020
     ctggcgccca gcgacaccgc ggcctacaag cgcggcgaac tcgtggagcc ggccgagccg      1080
     atcgtgtact acgtggaccg cacggtgccc gaccggtacc gcgagtacgt gaagcagggc      1140
     atcgaggcct ggaacgaggc ctaccgcgcc gccgggtaca aaaacgcggt cgaggcccgg      1200
     gtcgcgccgg acgattccac gtggagcgcc gaggacatcc gctactccac ggtgcggtgg      1260
     acggcggccc accagatggg ctacgccatc ggcccctcgc agacggaccc gcggacgggc      1320
     gagattctga acgccgacat cctcatctcc tcctcgttcg tgcgcggctg gcaggacacc      1380
     tatagccaga tcacccccgg cccgagcgcg gacacgggcg ccctcgccca ggggccggtg      1440
     tcgtcccgca cccccaaggc cctccgcaag atgctctcgc cggagctggc ccggcaggcc      1500
     tgctgggcgg agcgcggcat ggcacagcag atcggcctgc agcgaaccct cctcctcgcc      1560
     cgaggcgcca tcgctcccgg cgagtccatg cccgagaagt acctcggcgc ggccatcaag      1620
     gacctcgtca tgcacgaggt cggtcacacg ctcggcctgc ggcacaactt caaggcctcc      1680
     tccggcatcc ccaacgacga gctccacgac gagagctaca ccgaagagca cggggtgagc      1740
     ctgtcggtga tggactacgc ccccgtcaac gttgccctcg acgaggagga gcagggccac      1800
     tactggaacc caaccgtggg gccctacgac gagtgggcca tcaagtacgg gtacatgccc      1860
     atcgccgagc aatccgacga cggcgccctg acccgaaacg ggcccctcgc cgacacggcg      1920
     accgccgcga cggcgggcct ccacaagatt gccgccacgt cgagcgaccc gacgcaccgc      1980
     tacggcaccg acgaggacac ctggctgggc ggctacgccg tcgacccgct gacgaacgcc      2040
     tgggagctgg gcagcgaccc gatggccttc gccgagaccc gcgcggccct cgtgaaaacg      2100
     gtgatgccga agctcgaaga ccggctcgtc tcggcgggcg agcgctacta ccccctccgc      2160
     cgggccacca cggccctcct catggagcgg taccggtcgc ttcgtcccgt tacgaagacc      2220
     gtgggcggca gctacgtggc ccgcgaccac aagggcacgc ccgacgcccg tcccccgctt      2280
     cggcccgtac cggcggagga gcagcgcgag gccgtacaac tgctcgtaga cgaggccttc      2340
     gcccccgacg ccttcgagtt tgacccggaa cggctcaaca agctggcccc aaaccgacgc      2400
     tcgcactggg gcacgtcccc gagccttccc ctcgactacc ccgtgcaccg ccgcgtccac      2460
     accatacagc gcaacctgct ccgcgagctg ctccacccgg cccgcctgca gcgcatgatc      2520
     gacgcccagg cccgcacccc ggacggcgcc gggtacgcac cgggcgccct cttccggaca      2580
     atgaccgacg ccatctggag cgagctcgac acggccggcc cccagcccgc ccccatcaat      2640
     tcgttccggc ggccgctgca gcgcacctac gccgacatgc tgattgaact catgatgggc      2700
     accaccagct ggatcaccat caccacggcc ggcatcgacc agatcgacgc ccccgaggat      2760
     gtccgctcgg tggcacggct ggagctgacc gagctgtccg accagatcga gaccgccctg      2820
     ggcactcccg gtctgaagcg ggagacacgg gcccacctgt ccgagacgca ggcccgcatc      2880
     gaccgggccc tgaacgcatc gctggacctg agcccgtag                             2919
//

If you have problems or comments...

PBIL Back to PBIL home page