(data stored in ACNUC30630 zone)

EMBL: FP565814.PE437

FP565814.PE437       Location/Qualifiers
FT   CDS_pept        533711..535321
FT                   /transl_table=11
FT                   /locus_tag="SRM_00437"
FT                   /product="Conserved hypothetical protein, outer membrane,
FT                   containing RagB/SusD domain"
FT                   /db_xref="EnsemblGenomes-Gn:SRM_00437"
FT                   /db_xref="EnsemblGenomes-Tr:CBH23358"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR012944"
FT                   /db_xref="InterPro:IPR033985"
FT                   /db_xref="UniProtKB/TrEMBL:D5H5Q3"
FT                   /protein_id="CBH23358.1"
FT                   /translation="MPNNYHLMFIKRSLRAVLFITLAVGLLGCDAGVQPRSSASPETAF
FT                   QDESSYRAFLGKLYGGLVLTGQDGPAGNPDLQLIDEGFSQYVRAYWQLQELPTDEAVLA
FT                   WGDEGIQPLNKQQWTPANPFVEAMYNRIFFQASMVNEFLRQTTEAKLNERGVSEDMRQR
FT                   VQQFRAEARFLRALSYWHGVDLFGGMPIVTEEDEIGLQSPTPNTREEVFNFVEQELLAI
FT                   EDQMPAPGAAEYGRADQAAVWMVLSKLYLNAEVYVGEPHYEEVITYTDKIIGSEAYELA
FT                   DEYMHNFKADNHTSPEVIFPVPQDGEQTRTYGGTTFLGHAAIGGGTMNANNYGFGGGWW
FT                   GLRTTSNVVNRYPSDSTDVDSRAIFFTQGQSKEVGSLTSFTEGYALPKYQNVTTGGEKG
FT                   ENSTFPDTDYPMFRLADAYLMYAEAVARGAGGSMSKAVGLVNDLRERAYGDPSGNITAS
FT                   ELTPEFILDERGRELVWEGHRRSDLIRFNQFSENGTWSGKGGSIEGTTTQGFRDLYPVP
FT                   ESQLQVNENLEQNPGYGGS"
     atgccaaaca actaccacct tatgtttatt aagcgatcgc ttcgagccgt tcttttcatc        60
     accttggccg ttgggctgct ggggtgcgat gccggagtac agccgcgaag ttcggcctcc       120
     ccagaaacgg cgtttcagga tgagtcctcg tatcgtgcct ttcttggcaa gctgtacggg       180
     gggttggtcc tgacaggaca agacggcccc gcagggaatc cggatctaca actcattgac       240
     gaggggtttt cccagtacgt ccgtgcgtat tggcagctcc aagagcttcc gacagacgaa       300
     gcggttctcg cttgggggga tgagggcatc cagcccctca acaaacagca gtggacgccg       360
     gccaatccct tcgttgaggc gatgtacaac cgcatcttct tccaggcttc gatggtgaac       420
     gagtttctcc gccagacgac ggaggcaaag ctgaacgaac ggggagtgtc ggaggacatg       480
     cgtcagcgcg tccagcaatt ccgggccgaa gcacggttcc tgcgtgcgct cagctactgg       540
     catggcgtgg acctattcgg cggcatgccc atcgtgacgg aggaggacga gattgggctt       600
     cagtcgccca ccccgaacac gagagaagag gttttcaatt tcgtcgagca ggagcttctg       660
     gccatcgagg atcaaatgcc ggcaccgggt gctgcggaat acggccgcgc cgaccaggcg       720
     gcggtatgga tggtcctctc taagctgtac ctcaatgcgg aggtgtacgt cggcgagcct       780
     cactacgagg aggtgatcac ctataccgat aagatcattg gttccgaggc ctacgagctc       840
     gcggacgagt acatgcacaa ctttaaggcc gataaccaca cgtcgccgga ggtcatcttc       900
     cctgttcccc aagacgggga gcaaacgcgc acgtacggcg gcacgacgtt tctcggccac       960
     gccgcgatcg gtggaggaac gatgaacgcc aacaactatg gatttggcgg tggatggtgg      1020
     ggacttcgta caacctcaaa cgtcgtgaat cgctacccgt cggactccac ggacgtcgat      1080
     tcgcgggcga tcttcttcac gcagggccaa tccaaggagg ttggcagcct cacgagcttc      1140
     actgaaggct atgcccttcc gaaatatcag aacgtcacga ccggcggaga gaagggagag      1200
     aacagcactt tcccggacac ggactaccca atgtttcggc tcgcggacgc gtacttgatg      1260
     tacgcggagg ccgtagcacg tggggccggc ggaagcatga gcaaggcggt tggtctcgtg      1320
     aatgatctgc gtgagcgggc ctacggtgac ccgagtggga acatcactgc cagtgagctc      1380
     acccccgagt tcattctgga cgagcgagga cgagagctgg tatgggaagg gcaccgccgc      1440
     tccgatctga ttcgattcaa ccagttctca gagaatggaa cgtggtccgg caagggggga      1500
     agcatcgaag ggaccactac gcagggcttc cgtgatctgt accccgttcc ggagtcgcag      1560
     cttcaggtca acgaaaacct ggagcagaac ccgggctacg gcggaagcta g               1611
//

If you have problems or comments...

PBIL Back to PBIL home page