(data stored in ACNUC30630 zone)

EMBL: FP565814.PE447

FP565814.PE447       Location/Qualifiers
FT   CDS_pept        547885..549108
FT                   /transl_table=11
FT                   /locus_tag="SRM_00447"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SRM_00447"
FT                   /db_xref="EnsemblGenomes-Tr:CBH23368"
FT                   /db_xref="GOA:D5H5R3"
FT                   /db_xref="InterPro:IPR010502"
FT                   /db_xref="UniProtKB/TrEMBL:D5H5R3"
FT                   /protein_id="CBH23368.1"
FT                   /translation="MEAVPIFRPHCGPILCLLFCEALLFPSARGSMRRFLLTTIVGVFV
FT                   LVLAGGESVSALVGRPSGDAAKNNPESEAPPRTYAIYRASGPIAVDGRLDERDWAAAPW
FT                   TADFVDIRGRDAPTPRFRTRAKMLWDDEALYVAASLEEPDVWGTLTQRDTVVYYDDDFE
FT                   VFIDPNGTTHNYYEVEVNALETVWDLMLLKPYRDGGPAVDAWDVRGIDAAVHVQGTLND
FT                   PSDTDDGWTVEIKLPWSSLEEAAPGGRPPQAGEQWRLNFSRVDWPLAVKNGTYEKDLDT
FT                   TKAHPERNWVWSPQGAIDMHRPEHWGIVQFADAEVGTATVSVDERPNRRVKAALRRLYH
FT                   RQRAHHEAHGTYAGSLSALNASNVQLPERDFAPTLRTTQTMYEIAAPGAEGTTVHIRQD
FT                   GKVWVTGE"
     ttggaagcgg ttccgatttt ccgtccccat tgcggaccga tcctgtgcct tctattctgt        60
     gaggcgctgc ttttcccgtc ggcccgcggt tccatgcgac gctttctctt gacgacgatc       120
     gtcggcgttt tcgttctcgt cctcgcaggg ggcgagtcgg tctccgccct ggtggggcgg       180
     ccctcggggg acgccgcgaa aaacaatccc gagagcgagg cgcccccgcg cacctacgcc       240
     atctaccgcg cgtccggacc gattgccgtg gacgggcggc tcgacgaacg cgactgggcc       300
     gcggcgccgt ggaccgccga cttcgtcgac attcgtgggc gcgacgcccc gacgccgcgg       360
     ttccgcaccc gggccaagat gctgtgggac gacgaggccc tttacgtggc ggcctccctc       420
     gaggagccgg acgtgtgggg caccctcacc cagcgggaca cggtggtgta ctacgacgat       480
     gacttcgagg tcttcatcga ccccaacgga acgacgcaca actactacga ggtggaggtg       540
     aacgcgctcg agaccgtgtg ggacctgatg ctcctgaagc cctaccgcga cggcggaccg       600
     gccgtcgacg cctgggacgt acggggcatc gacgcggccg tgcacgtgca gggcacactc       660
     aacgacccct cggacaccga cgacgggtgg acggtggaga taaagctgcc gtggtcgtcg       720
     ttggaagagg ccgcccccgg cggacgtccg ccccaggccg gcgagcagtg gcgcctcaac       780
     ttctcgcggg tcgactggcc ccttgccgtc aagaatggca cctacgaaaa ggacctcgac       840
     accacgaagg cgcatccgga gcgcaactgg gtgtggtcgc cgcagggagc catcgacatg       900
     caccggcccg aacactgggg catcgtgcag ttcgcggacg ccgaggtcgg caccgcgacc       960
     gtgtccgtcg acgagcgccc caatcggcgc gtcaaggcgg ccctgcggcg cctctaccac      1020
     cgtcagcggg cgcaccacga ggcgcatggc acgtacgccg ggtccctctc ggccctcaac      1080
     gcctcgaacg tgcagcttcc cgagcgcgat tttgccccca cgctccgcac gacccagacg      1140
     atgtacgaaa tcgcggcgcc cggggcggag ggaacgaccg tgcacatccg tcaggacgga      1200
     aaggtctggg tgaccgggga gtga                                             1224
//

If you have problems or comments...

PBIL Back to PBIL home page