(data stored in ACNUC30630 zone)

EMBL: FP565814.PE47

FP565814.PE47        Location/Qualifiers
FT   CDS_pept        45202..45939
FT                   /transl_table=11
FT                   /locus_tag="SRM_00046"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SRM_00046"
FT                   /db_xref="EnsemblGenomes-Tr:CBH22967"
FT                   /db_xref="UniProtKB/TrEMBL:D5H4L2"
FT                   /protein_id="CBH22967.1"
FT                   /translation="MDRRYALTGVANRSVTSVCRGTIRLGLDGGAEPLCRTGACQTNSS
FT                   HTSPCTADPSAMGEHAPPRSLQQLRAEWRERLQSARDRAASQVDDMGLADLRALRATIG
FT                   EEMERVEDRLPDPGPVETKGPMTAEQQAEHVQAALQYHALQVRKQLVAHELRRRALGPA
FT                   AVEQEIEVPPTTRHYATLAWDVMGETDAETTADVYREVARRAEEDVHLTTVEMWLREKN
FT                   PHHPEETDGRWTELRRAVLLASA"
     atggacagga gatatgcgtt gacgggtgtg gcgaacagat ctgtaacaag cgtctgccgg        60
     gggacgatcc gtctcgggct ggatgggggg gcggaaccac tttgccggac cggggcgtgt       120
     caaaccaact cctcgcacac aagtccatgc actgccgatc cgtccgcaat gggtgagcac       180
     gccccgcccc gatctctcca gcagcttcgg gccgagtggc gcgagcggct gcaatcggcc       240
     cgcgaccgcg ccgcctcaca ggtcgacgac atgggccttg cggacctgcg ggccctccgg       300
     gcgacgattg gggaagaaat ggagcgggtg gaggaccgcc ttcccgatcc gggccccgtc       360
     gaaaccaagg gcccgatgac ggccgagcag caggccgagc acgtccaggc ggcccttcag       420
     taccacgcgc tgcaggtgcg gaagcagctc gtcgcccacg agttgcggcg ccgcgccctc       480
     ggccccgccg cggtggaaca ggagattgag gtgcccccca ccacccgaca ctacgctacc       540
     cttgcctggg acgtgatggg ggagacggac gcggagacca ccgcggacgt ataccgcgag       600
     gtggcccgtc gtgcggagga ggacgtgcac ctcacgacgg tggagatgtg gctgcgggaa       660
     aagaaccccc accatcccga agagacggac ggccgctgga cggagctccg tcgggccgtg       720
     ctcctggcgt ccgcttag                                                     738
//

If you have problems or comments...

PBIL Back to PBIL home page