(data stored in ACNUC30630 zone)

EMBL: FP565814.PE478

FP565814.PE478       Location/Qualifiers
FT   CDS_pept        complement(584330..584443)
FT                   /transl_table=11
FT                   /locus_tag="SRM_00479"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SRM_00479"
FT                   /db_xref="EnsemblGenomes-Tr:CBH23400"
FT                   /db_xref="UniProtKB/TrEMBL:D5H5U5"
FT                   /protein_id="CBH23400.1"
FT                   /translation="MTLASTDPIAMVTAQSKALPFEKICSPTSQAYRMCNP"
     gtgacgctgg cgagcaccga cccgatcgcg atggtgacgg cacagtcaaa ggcactcccc        60
     ttcgagaaga tatgcagccc gacgagtcag gcgtacagga tgtgcaaccc gtag             114
//

If you have problems or comments...

PBIL Back to PBIL home page