(data stored in ACNUC30630 zone)

EMBL: FP565814.PE479

FP565814.PE479       Location/Qualifiers
FT   CDS_pept        584427..584810
FT                   /transl_table=11
FT                   /locus_tag="SRM_00478"
FT                   /product="Conserved hypothetical protein, membrane"
FT                   /db_xref="EnsemblGenomes-Gn:SRM_00478"
FT                   /db_xref="EnsemblGenomes-Tr:CBH23399"
FT                   /db_xref="InterPro:IPR007353"
FT                   /db_xref="InterPro:IPR023090"
FT                   /db_xref="UniProtKB/TrEMBL:D5H5U4"
FT                   /protein_id="CBH23399.1"
FT                   /translation="MLASVTLWQKPTLLEGAVTMGMLFTLQFVVGNLHKRVPGVTRLVD
FT                   TRRPLLMDGTEVLCDNLRRANVTEADLRAKLREANVTRWSQVRAIVMELTGDVSVLHAP
FT                   PDAPPIDKSLLAGGGTGPDRESG"
     gtgctcgcca gcgtcacgct ctggcagaag ccgacgctcc tggaaggcgc cgtcacgatg        60
     ggaatgcttt tcacccttca gtttgtcgtc ggaaatctgc acaagcgggt gcccggcgtc       120
     acccgtcttg tcgacacccg ccggccgctg ctcatggacg gaacggaggt gctgtgcgac       180
     aacctgcgcc gggccaacgt gacggaggcc gacctgcgcg ccaagctccg agaggcgaac       240
     gtgacgcggt ggtcgcaggt gcgcgccatc gttatggagt tgacgggcga cgtgtcggtg       300
     ctgcacgccc cgccggacgc gccgccgatt gataaatcgc ttctcgcggg gggaggaacg       360
     gggccggacc gcgaatctgg atag                                              384
//

If you have problems or comments...

PBIL Back to PBIL home page