(data stored in ACNUC30630 zone)

EMBL: FP565814.PE511

FP565814.PE511       Location/Qualifiers
FT   CDS_pept        620493..621512
FT                   /transl_table=11
FT                   /locus_tag="SRM_00511"
FT                   /product="glycine betaine ABC transporter glycine
FT                   betaine-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:SRM_00511"
FT                   /db_xref="EnsemblGenomes-Tr:CBH23432"
FT                   /db_xref="GOA:D5H5X7"
FT                   /db_xref="InterPro:IPR007210"
FT                   /db_xref="UniProtKB/TrEMBL:D5H5X7"
FT                   /protein_id="CBH23432.1"
FT                   /translation="MKRLITAARALCRSYCAAAVAASLLALGTMGCGGDASDSAGGGAS
FT                   ASSPPLKMVTVNWIEGLAMSYMQAQVLEDSLNVPVDLKEAQGGGIAFSSVAEGDRDFFN
FT                   EAWLPTTHQNSWGDLQGQLQKLGYTYRGTSGGLVVPAYMDLRSAANIGEYREALGEKIY
FT                   GIEAGSPTNDNIRQVLDQHGIEGFSVVAASGPATWQRLRSAIQDRQPIIVAGWKPHWKW
FT                   SAFDLRYLQDGKTNQSPAYGPPEDIFTVVDNQFIDEFPKEAVCFLQKFEVTDQQIGSLM
FT                   NTFRTRGDMSKSGAAEQWVRNHPEHVTQWLDQAEACAASDEAVTPLPDDATHSRDQEA"
     atgaaacgac tcatcactgc ggcacgcgcc ctgtgccgct cgtactgcgc ggcggccgtt        60
     gccgcgtcgc tccttgcgct gggcacaatg ggctgtgggg gggatgcctc cgacagcgcc       120
     ggtggtggcg cgtcggcatc gtcgcccccc ctgaagatgg tgacggtgaa ctggatcgag       180
     ggcctcgcca tgagctacat gcaggcccag gtgctggagg acagcctgaa cgtgccggtg       240
     gacctgaagg aagcccaggg cggcggcatc gccttttcgt cggtggcgga gggggatcgg       300
     gactttttca acgaggcctg gctccccacc acgcaccaaa actcgtgggg cgacctccag       360
     ggtcaactcc aaaagctcgg ctacacgtac cggggcacct cgggcgggct cgtggtgccg       420
     gcgtacatgg accttcgctc ggcggccaac atcggggagt accgcgaggc gctcggcgaa       480
     aagatctacg gcattgaggc cggctccccc accaacgaca acatccgcca ggtgctggac       540
     cagcacggca tcgagggctt ctcggtggtg gcggccagcg gcccggccac gtggcagcgc       600
     ctccgaagcg ccatccagga ccgccagccg atcatcgtgg cggggtggaa gccgcactgg       660
     aagtggagcg cgtttgacct tcggtacctc caggacggaa agacgaacca gtcgcccgcc       720
     tacgggccgc cggaggacat cttcacggtc gtcgacaacc agttcatcga cgagtttccg       780
     aaagaggccg tctgcttcct gcaaaagttt gaggtgaccg atcagcagat cggcagcctc       840
     atgaacacgt ttcgcacccg cggcgacatg agcaagagcg gggccgccga gcagtgggtg       900
     cggaaccacc cggagcacgt cacccagtgg ctcgaccagg ccgaggcgtg tgccgcctcg       960
     gacgaggccg tgacgcccct cccggacgac gcgacccact cacgcgatca ggaggcgtag      1020
//

If you have problems or comments...

PBIL Back to PBIL home page