(data stored in ACNUC30630 zone)

EMBL: FP565814.PE512

FP565814.PE512       Location/Qualifiers
FT   CDS_pept        621669..622964
FT                   /transl_table=11
FT                   /locus_tag="SRM_00512"
FT                   /product="conserved hypothetical protein, secreted"
FT                   /db_xref="EnsemblGenomes-Gn:SRM_00512"
FT                   /db_xref="EnsemblGenomes-Tr:CBH23433"
FT                   /db_xref="UniProtKB/TrEMBL:D5H5X8"
FT                   /protein_id="CBH23433.1"
FT                   /translation="MNRYCTAVLALFLTAGLMLPGSALADDPEPADDSTNATSLVANAW
FT                   ESDNTTAAPQQDEPTLDVSFNGSLRFNALFRSYGAGQNGNFEDQADNVLGNGGFTFDTF
FT                   RIGASGSYGSLIFDAEWAFYPESFGGNYIHHGWVGYEFSDARQIQVGVSQVPFGIQPYA
FT                   SSSWFFNNTYYVGLEDDYEAGIKAMYQANGWDIQGAYYMNSEQVDFFGASNAGRYSYDV
FT                   VPSTSAGYIDTRGVTEQHQFNAKVAYSFDHGGLGFTKVGVSGQRGQLLNQGTGETDWHA
FT                   AYAAHLQGRYGGFEAKLEFAQQELNPPSVTDDRFVVMGAYGSPNRVASEHNVYSSSLAY
FT                   HIPVNAGPISEIKPYYDFSQVTKDVDAWNDNVNHDIGFLTSAGPLFVYTDLIISKGHPF
FT                   NQPFDGTFSGVMAEQNDNEWRTAFNVNIGIYF"
     atgaatcggt actgcactgc agttctcgcg ctttttctca ccgctggatt gatgcttccc        60
     ggctcggccc tcgccgacga cccggagccc gccgatgaca gcaccaacgc cacctccctg       120
     gtcgccaacg cctgggagag cgacaacacg acggcggcgc cccagcagga cgagccgacg       180
     ctcgacgtga gctttaacgg ctcgcttcgc ttcaacgccc ttttccggtc gtatggcgcc       240
     ggccagaacg gaaactttga ggaccaggcc gacaatgtac ttggaaatgg tggattcacg       300
     ttcgatacct tccggattgg ggccagtggg tcctacggaa gcctcatttt cgacgccgag       360
     tgggcgttct acccggagtc gtttgggggc aactacattc accatggctg ggtcgggtac       420
     gaattcagtg acgcccgcca gattcaggtc ggcgtgagcc aggtgccgtt cgggattcag       480
     ccgtacgcct ccagcagttg gttcttcaac aacacgtact acgtcggcct agaggacgac       540
     tatgaggccg gcatcaaggc gatgtaccag gccaatggct gggacatcca gggggcctat       600
     tacatgaact ccgagcaggt cgacttcttc ggcgctagca atgcggggcg gtactcctac       660
     gacgtagtcc cgagcacgag cgccggatac atcgacaccc gcggtgtgac cgaacagcac       720
     cagttcaacg caaaggtggc ctactccttt gaccacggtg ggctcggctt cacgaaggtc       780
     ggtgtgtccg gacagcgggg ccagctcctg aatcagggaa ctggcgaaac cgactggcat       840
     gccgcgtacg ctgcgcacct tcaggggcgc tacggcggct tcgaggcgaa gttggagttt       900
     gcccagcagg agctgaaccc cccaagcgtg accgacgacc gcttcgtcgt gatgggggct       960
     tacgggtctc ccaaccgagt ggcgagtgag cacaacgtgt actcgtccag tctggcgtac      1020
     cacattccgg tgaatgccgg cccgatctcg gagatcaagc cgtactacga cttcagtcag      1080
     gtgacgaagg acgtggacgc gtggaatgac aacgtcaacc acgacatcgg ctttctcacg      1140
     tcggccggtc cgctgttcgt ctacacggac ctgattatta gcaaggggca tccgttcaac      1200
     cagccgtttg acggaacctt ctccggtgtc atggcggagc agaacgacaa cgaatggcga      1260
     acggccttca acgtgaacat cgggatctac ttctaa                                1296
//

If you have problems or comments...

PBIL Back to PBIL home page