(data stored in ACNUC30630 zone)

EMBL: FP565814.PE515

FP565814.PE515       Location/Qualifiers
FT   CDS_pept        complement(625518..625724)
FT                   /transl_table=11
FT                   /locus_tag="SRM_00515"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SRM_00515"
FT                   /db_xref="EnsemblGenomes-Tr:CBH23436"
FT                   /db_xref="UniProtKB/TrEMBL:D5H5Y1"
FT                   /protein_id="CBH23436.1"
FT                   /translation="MGRFPDVFTRLRLGVCPGTQPAARNATRPVNASPSDHLAPPVAGE
FT                   RQTSSNIWACILHVGRVLLILEA"
     ctgggccggt ttcccgacgt cttcactcga ctgcgtctcg gcgtctgccc cggcacgcag        60
     ccggccgcac ggaacgccac ccggcccgtg aatgcatccc cttccgacca cctggcccct       120
     cccgtcgcgg gcgagcggca aacttcgtca aatatttggg cgtgcatcct gcatgtgggc       180
     cgcgtcctcc tgattttaga agcttga                                           207
//

If you have problems or comments...

PBIL Back to PBIL home page