(data stored in ACNUC30630 zone)

EMBL: FP565814.PE550

FP565814.PE550       Location/Qualifiers
FT   CDS_pept        complement(675911..676276)
FT                   /transl_table=11
FT                   /locus_tag="SRM_00550"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SRM_00550"
FT                   /db_xref="EnsemblGenomes-Tr:CBH23471"
FT                   /db_xref="UniProtKB/TrEMBL:D5H616"
FT                   /protein_id="CBH23471.1"
FT                   /translation="MLLYYKRKIFPDFAPRHPSLRPSLSPLGPVRICPTVTLRQSKEDS
FT                   DPPTPPVTDWFCVVDRSPAAAEEQWALADGSVVLTLSATRADAMAVADLDGVGIVRYGH
FT                   LSDSDRAALRRHLAPYR"
     ttgttgcttt actacaagcg gaagattttt ccggactttg ccccgaggca tcccagtttg        60
     cgtccctcct tatcacccct tggacccgtt cgcatttgcc caaccgttac ccttcgccaa       120
     tcgaaagaag attctgaccc gcctacccct ccggtgacgg actggttctg cgtggtggac       180
     cgctctcccg cagcggcgga agagcagtgg gccctcgccg acggaagtgt ggtactgacc       240
     ctctcggcaa ctcgggccga cgcaatggca gtggccgacc tggatggcgt cggcatcgtc       300
     cggtatggcc acctgtccga ttccgaccgg gcggccctgc gccggcacct cgctccctac       360
     cgctaa                                                                  366
//

If you have problems or comments...

PBIL Back to PBIL home page