(data stored in ACNUC30630 zone)

EMBL: FP565814.PE57

FP565814.PE57        Location/Qualifiers
FT   CDS_pept        56135..56626
FT                   /transl_table=11
FT                   /locus_tag="SRM_00057"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SRM_00057"
FT                   /db_xref="EnsemblGenomes-Tr:CBH22978"
FT                   /db_xref="UniProtKB/TrEMBL:D5H4M3"
FT                   /protein_id="CBH22978.1"
FT                   /translation="MTRQPEPGNAPEGNAPRSFGLSQSQRWGAASGLLFFLLVVGTDYA
FT                   SGVAAREWSELALDAGIVGGLVLVVFNAFRKSVLVGENEIRKVQPLWNDQSVQISEIRR
FT                   VHVPTIENGLWLYTDPDGNPVLTIGGGLEAPDELEERVIQHAPSDAAVTGLGHRANGSS
FT                   "
     atgacccgcc aacccgagcc cggaaacgct cctgaaggaa acgcgccccg cagttttggt        60
     ctttcccaat cccagcgttg gggggccgcg tccggtcttc tgttctttct cctggtcgtc       120
     gggacagact acgccagtgg ggtggcggcc agggagtggt cggagctggc cctagatgcc       180
     ggcatcgtgg gcggactcgt tctcgttgtt ttcaacgcct tccggaagag cgtcctggtg       240
     ggagagaacg agattcgaaa ggtccagccg ctgtggaacg accagtccgt ccagatcagt       300
     gagatccggc gggtccacgt cccgacgatc gaaaatggcc tctggctcta caccgacccg       360
     gatggaaatc cggtgctgac gatcggcggg ggactcgaag cccccgacga gcttgaggag       420
     cgggtgattc agcacgcccc ctccgacgca gcggtgacgg ggctggggca ccgggcaaac       480
     ggctcgtcgt ag                                                           492
//

If you have problems or comments...

PBIL Back to PBIL home page