(data stored in ACNUC30630 zone)

EMBL: FP565814.PE581

FP565814.PE581       Location/Qualifiers
FT   CDS_pept        714572..715489
FT                   /transl_table=11
FT                   /locus_tag="SRM_00581"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SRM_00581"
FT                   /db_xref="EnsemblGenomes-Tr:CBH23502"
FT                   /db_xref="GOA:D5H647"
FT                   /db_xref="UniProtKB/TrEMBL:D5H647"
FT                   /protein_id="CBH23502.1"
FT                   /translation="MPVRWRRRGRAFPDGDASSPRRRSDPFAPARPGIHGNKECVARIR
FT                   IDDGPPPGSAARVRTAWDDRFPTSWGPRAARRRISCHGLRRKRTSGEPPFMQFPERPFD
FT                   GEASGDGAPSYEWLDEWLCEYVDGTMDPSVEAVFEQYVEANPELRAHIERLRQTRELLC
FT                   GGEDTGAPPTAPMEAAREVEEDLLRDAAPELLASEETSRSVVALGLASSIAMALVVGFL
FT                   AGSMLVEPSTLSSGPATAIERQAAPSEGGDEASPRRGAADRGRPPRASSFSSADRLLTL
FT                   PAEAPSPSTDTGRAAPTFMTAGER"
     atgcccgtcc ggtggcggcg tagggggaga gcgttcccgg acggtgacgc gtcgtctcca        60
     cggcgccgtt cagatccgtt tgcgccggcc aggcccggaa ttcacggaaa caaggagtgc       120
     gtagcccgaa tacgtatcga tgacgggccg ccccccggat ccgcagcgcg tgttcgcacc       180
     gcatgggacg atcgtttccc cacgtcgtgg ggcccgaggg cggctcgacg gaggatctcg       240
     tgccacggtc tccgacgcaa acgtacatcc ggcgaaccac cgtttatgca gttccccgag       300
     cgaccctttg acggagaggc gtccggcgac ggggcccctt cctacgagtg gctcgacgag       360
     tggctctgcg agtacgtgga cgggacaatg gacccttcgg tggaggccgt ctttgagcag       420
     tacgtggagg ccaatcctga gctgcgggcc cacatagagc gccttcgcca gacgcgcgaa       480
     ctgctctgcg ggggtgagga caccggggcg ccgcccacgg ccccgatgga agccgcgcga       540
     gaggtggaag aagaccttct ccgagacgcc gctccagaac tgcttgcgtc ggaggagacc       600
     agtcggtccg tcgtggccct cgggcttgcg tcgtccattg cgatggccct cgtcgtggga       660
     tttctcgccg ggtcgatgct cgtggagccg tctacgctct cgtccggacc ggccactgcg       720
     attgagcgac aggccgcgcc gtcggagggg ggagacgaag catcgccgcg ccggggcgca       780
     gccgaccggg gccgaccgcc gcgcgcctca tcgttttcgt cggccgaccg gcttctcaca       840
     cttccggcag aggccccgtc accgagcacc gacacgggcc gtgccgcacc gacgtttatg       900
     acggccgggg agcgctga                                                     918
//

If you have problems or comments...

PBIL Back to PBIL home page