(data stored in ACNUC30630 zone)

EMBL: FP565814.PE6

FP565814.PE6         Location/Qualifiers
FT   CDS_pept        5369..6295
FT                   /transl_table=11
FT                   /locus_tag="SRM_00006"
FT                   /product="SCO1/SenC family protein"
FT                   /db_xref="EnsemblGenomes-Gn:SRM_00006"
FT                   /db_xref="EnsemblGenomes-Tr:CBH22927"
FT                   /db_xref="GOA:D5H4H2"
FT                   /db_xref="InterPro:IPR003782"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:D5H4H2"
FT                   /protein_id="CBH22927.1"
FT                   /translation="MPDTRPAKAGGQPRPFFRLGVVRFGLATALVLFWVGAFASTATGQ
FT                   RTSRTPDQLENVGVDQKLGATIPKDLSFQNEQGEPVRLSQYFDGSTPVMLTLNYHRCPQ
FT                   LCRIQLQKFTKSLSGMSWTAGDKFKVLTVDISPYEGPKMARKAQERYATFLDRPEETVD
FT                   GWHFLTGNQAAIETLTDSVGFRYQPLPEKEKQFAHPTTIIFLSGDGTITRYFTTLDPAP
FT                   GDLRTALVEASDGTVGNVVDKAFLACARFNPDSNSYSASAFKLMQYGSVLTVIVMGAAL
FT                   FVFWRRENEQLETAHEEGLNAMVDEQA"
     atgcccgata cacgtcctgc gaaggcgggc gggcagcccc gccccttctt tcggctcgga        60
     gtcgttcggt tcggattggc aacggccctc gtgctgttct gggtcggggc ctttgcctca       120
     acggccaccg gccagcgaac cagccgcacc ccggaccagc ttgagaacgt gggggtggac       180
     cagaagctcg gcgcgacgat cccgaaggac ctctcgtttc aaaacgagca gggagagcca       240
     gtccgtctca gtcagtactt cgacgggtcg acgccggtca tgctgaccct caactaccac       300
     cggtgccccc agttgtgtcg cattcagctg cagaagttca ccaaatccct gagcggcatg       360
     tcgtggacgg ccggcgacaa attcaaagtg ctcaccgtcg acatcagccc ctacgaaggc       420
     cccaagatgg cccgaaaggc ccaggagcgc tacgccacgt ttctggaccg tcccgaagag       480
     acggttgacg gctggcactt tctgaccggc aaccaggcag cgatcgaaac gcttaccgac       540
     tcggtgggct tccgctacca gccccttccg gagaaggaga agcagtttgc ccaccccacg       600
     acgatcatct tcctgagtgg cgacggcacc attacccgct actttaccac cctcgacccg       660
     gccccgggcg acctgcggac ggcgctcgtc gaggcctccg acggcacggt cggcaatgtc       720
     gtcgacaagg ccttcctggc ctgtgcgcga ttcaatccgg actcgaattc ctactccgcg       780
     agtgcattca agctaatgca gtacggcagt gtcctcacgg tgatcgtaat gggggccgcg       840
     ctgtttgtct tctggcgccg cgaaaacgag cagctcgaga cggcacacga ggaagggctc       900
     aacgcgatgg ttgacgaaca ggcatga                                           927
//

If you have problems or comments...

PBIL Back to PBIL home page