(data stored in ACNUC30630 zone)

EMBL: FP565814.PE613

FP565814.PE613       Location/Qualifiers
FT   CDS_pept        complement(744882..745718)
FT                   /transl_table=11
FT                   /locus_tag="SRM_00613"
FT                   /product="Conserved hypothetical protein, secreted"
FT                   /db_xref="EnsemblGenomes-Gn:SRM_00613"
FT                   /db_xref="EnsemblGenomes-Tr:CBH23534"
FT                   /db_xref="UniProtKB/TrEMBL:D5H679"
FT                   /protein_id="CBH23534.1"
FT                   /translation="MQPAPSKRARFLHIIVGGWLLALGGLGCTSPPEHGGTYAAFGALD
FT                   TIEATDTPRDSALAVLARLDRTAFDSAFARLDAYAVTRDVRTEQLDTTGATTAYRTRTL
FT                   RYPPGTGPGTIQQADSAGRFQAGGFLARLTPSQSPRARPGNLAGQALADQPAYLAPRTQ
FT                   EAYRYALRRDSLLDGTPTHVVEAKVRSGERGADRSIRYARLTVDRASHELVGLTTTRAS
FT                   RILLFRERSQITLRLRRAPDETWVPHLTRVRAVVDVPLRAPRQFRTVSAYRGYAVR"
     atgcagcccg ccccctccaa acgcgcccgt tttttacata tcattgtggg cgggtggctc        60
     ctggcgctcg ggggcctggg ctgtacgtcc ccccccgagc acggcgggac gtacgccgcg       120
     ttcggcgccc tcgacacgat tgaggccaca gacacgcctc gggactcggc cctcgccgtt       180
     cttgcgcgac tggaccggac ggcgttcgac tcggcctttg cccgtctcga tgcgtacgcc       240
     gtcacccggg acgtgcggac cgagcagctg gacacgaccg gggccaccac cgcctaccgg       300
     acgcgcacgc tccggtaccc gcccggcacc ggccccggca cgattcaaca ggccgactcg       360
     gccggccgct tccaggccgg cggatttttg gcacgcctca ccccttcgca gtcccctcgc       420
     gcccgtcccg gcaacctggc ggggcaggcc ctcgccgacc agccggcata cctcgccccc       480
     cgcacgcagg aggcctatcg ctacgccctg cgccgcgact cgcttctgga cggcacgccg       540
     acccacgtgg tggaggcgaa agtgcgctcg ggcgaacggg gcgccgaccg gagcatccgg       600
     tacgcccgcc tcacggtcga tcgtgcgtcg cacgaactgg tgggcctcac cacgacccgg       660
     gccagccgga ttctgctgtt ccgcgagcgg agccagatca cgctccgcct ccgccgcgcc       720
     cccgacgaga cctgggtgcc ccacctgacc cgcgtccggg ccgtcgtgga cgtgcccctt       780
     cgcgccccgc gccagttccg gacggtgtcg gcgtaccgcg ggtacgccgt ccgttag          837
//

If you have problems or comments...

PBIL Back to PBIL home page