(data stored in ACNUC30630 zone)

EMBL: FP565814.PE622

FP565814.PE622       Location/Qualifiers
FT   CDS_pept        756397..757326
FT                   /transl_table=11
FT                   /locus_tag="SRM_00622"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SRM_00622"
FT                   /db_xref="EnsemblGenomes-Tr:CBH23543"
FT                   /db_xref="InterPro:IPR029060"
FT                   /db_xref="UniProtKB/TrEMBL:D5H688"
FT                   /protein_id="CBH23543.1"
FT                   /translation="MGVEGWGLKGEGRAVVDGAHLDLQLHLARTGRHGRRPFDTGRRQR
FT                   RRDSREALESESGVTPASRARRERASSSPPPSPQSCPSGRGARRPRAAHAERGATGGRT
FT                   RHRWRRGRSGQQSRSQNDEVGICPFFPWLKGSNFGVKSEVLSRPNRSMPIRTYADTSVY
FT                   GGPYDEEFAEASRRFFAQVRVGRFLLVTSAVVSDELEEAPPKVQANYEALLPEVTVAEV
FT                   TDEALKLQQAYLDAGILTPTWEDDALHIAVATVQGCELIVSWNFQHVVHFQKIPQYNAV
FT                   NTLHGYDEIAIHSPHEVINDDDEFGEGV"
     ttgggtgttg agggttgggg gttgaagggg gaggggagag cggtagttga cggagcgcat        60
     ctggacctcc agctccatct tgcgcggact ggcaggcacg gacggaggcc attcgacacc       120
     ggcaggaggc aacggcgaag ggacagccgg gaggcacttg aatcggaatc gggagtcaca       180
     ccggcctccc gtgctcgacg tgagcgagca tcgtcgtcac ctcctccatc cccacaatcg       240
     tgtccatctg gtcgaggggc gaggcgtcct cgagcagcgc atgcggagcg cggagccact       300
     ggcgggcgga ctcgacaccg ttggaggcgt ggcaggtcag ggcaacaatc tcgatcacag       360
     aacgacgaag tcgggatctg tccgtttttc ccatggttga agggaagtaa ttttggggtc       420
     aaatcggagg tgttgtctcg cccgaaccgt tcgatgccaa tacgtaccta cgccgacacg       480
     tctgtctacg ggggaccata cgacgaagag ttcgcagagg ccagtcgacg gttttttgct       540
     caggtgcgtg tgggtcggtt tttgctcgtg acctcggcgg tcgtaagcga cgagttagaa       600
     gaggcgcctc caaaggtgca ggcgaactat gaggcattac tccccgaggt gacggtcgct       660
     gaggttacgg acgaggcact taagttgcag caggcatacc tggacgcagg cattctgaca       720
     ccgacctggg aggatgatgc cctgcacatt gctgtggcca ccgttcaggg ctgtgagctg       780
     atcgttagct ggaattttca gcacgtcgtg cacttccaga agattccgca gtacaacgca       840
     gtgaatactc ttcatggata cgacgaaatt gccatccatt ctccacatga ggtgatcaac       900
     gatgacgacg agttcggaga aggagtttga                                        930
//

If you have problems or comments...

PBIL Back to PBIL home page