(data stored in ACNUC30630 zone)

EMBL: FP565814.PE623

FP565814.PE623       Location/Qualifiers
FT   CDS_pept        757476..757865
FT                   /transl_table=11
FT                   /locus_tag="SRM_00623"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SRM_00623"
FT                   /db_xref="EnsemblGenomes-Tr:CBH23544"
FT                   /db_xref="UniProtKB/TrEMBL:D5H689"
FT                   /protein_id="CBH23544.1"
FT                   /translation="MNRDREAHRPPVFDVVADHRPLFRPRPLVSWNVRPLVYFDEIRWS
FT                   DVPDQEDKAIDVRSPRGAFAMENQSEEMGDGIDAVEITRRIRDERYEQMKDMTPAERLE
FT                   YYRKESAAAHARFVDRARNRPEEGN"
     ctgaatcgtg atcgggaggc acaccggcct cccgtgtttg acgtggtcgc ggatcatcgt        60
     cccctcttcc gtccccgccc actcgtgagc tggaacgtcc gccccctcgt gtatttcgac       120
     gaaatccgtt ggtctgacgt gcctgaccag gaagacaaag caatcgacgt tcgctcacca       180
     cgaggggcat ttgcgatgga gaatcagtcg gaggaaatgg gcgacgggat tgatgctgtg       240
     gagataacgc ggcggatccg ggatgagcgg tacgaacaga tgaaagatat gaccccggcg       300
     gagcgcctcg agtattatcg gaaagagagt gcggccgcgc atgcacggtt tgtcgatcgg       360
     gctcgcaacc gacccgaaga aggcaactga                                        390
//

If you have problems or comments...

PBIL Back to PBIL home page