(data stored in ACNUC30630 zone)

EMBL: FP565814.PE666

FP565814.PE666       Location/Qualifiers
FT   CDS_pept        810939..812399
FT                   /transl_table=11
FT                   /locus_tag="SRM_00666"
FT                   /product="Sensor kinase"
FT                   /function="# Member of the two-component regulatory system
FT                   cusS/cusR. Copper ion sensor. Could also be a silver ion
FT                   sensor. Probably activates cusR by phosphorylation."
FT                   /db_xref="EnsemblGenomes-Gn:SRM_00666"
FT                   /db_xref="EnsemblGenomes-Tr:CBH23587"
FT                   /db_xref="GOA:D5H6D2"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:D5H6D2"
FT                   /protein_id="CBH23587.1"
FT                   /translation="MSFVRSIRDALLPRRASTQTWMVLTFALFVGTAVVGVGLYVMLVL
FT                   RGEMRTAMQETLHDQADRIAVQAEQEPDPAGRGRIVDNLTELQDLHVSLVTPDTTYRPS
FT                   PQTAPPFPADTLVEVSALRNMTEETVRFARHDPDDGQQFFLAALYRPSANLIVQVGQPP
FT                   PPLYSLAQRSQVVLVLGMILALVLALIGSFIAAYQVTTPLTRISETARRVADGKLTGKI
FT                   QVESRAAEFQDLAESLNRASDTFREKIEELERMTRLQSEFIGNVSHEVRNPIFSISGYL
FT                   EALGTPGLDDEQRKMYSEKALTNLNRLQNLFNDLIDIARLEYKEDLINRSVFDLKDLVD
FT                   EVAEMLRPKAEEKGLDLEADVSRFFVHADRSRVRQVLTNLIENGIAYTGGGSVRCRVQR
FT                   RLDKVRVEVVDTGQGIDEDHLDRIFERFYRVDPDRSRESGGTGLGLSIVKQILQAHGED
FT                   IHVESTKGRGTRFWFELPYEPEPEAVEA"
     atgtctttcg ttcggtcgat tcgggacgcg ctcctgcccc gccgggcctc aacgcagacc        60
     tggatggtct tgacgtttgc cctgttcgtg ggcacggccg tcgtgggcgt ggggctgtac       120
     gtgatgctgg tcctccgggg agagatgcgg acggccatgc aggagacgct ccacgaccag       180
     gccgaccgga ttgcggtgca ggcggagcag gaaccggacc cggcggggcg tggacgcatc       240
     gtggacaacc tgacggagct gcaagacctg cacgtctccc tcgttacccc cgacacgacc       300
     taccgcccct ccccgcagac ggcccccccg tttccggccg acacgctggt cgaggtgtcg       360
     gccctccgga acatgacgga ggagacggtc cggtttgcac ggcacgaccc cgacgacggg       420
     cagcagttct tccttgcggc cctctaccgc ccctccgcga acctgatcgt gcaggtgggc       480
     cagccgcccc cgccgctgta ctcgctggcc cagcgctctc aggtcgtgct cgtgctgggg       540
     atgattttgg cactcgtgct ggccctcatc ggcagcttca tcgcggccta ccaggtcaca       600
     acccccctca cccgcattag cgaaacggcc cgccgggtgg cggatggaaa gttgaccggc       660
     aaaattcagg tcgagtcccg cgcggcggag tttcaggacc ttgccgagag cctcaaccgg       720
     gcctccgaca cgttccggga gaagatcgaa gagctggagc gcatgacccg gctgcagagc       780
     gagttcatcg gcaacgtctc ccacgaggtc cgcaacccga tcttttccat cagtgggtac       840
     ctggaggccc tcgggacgcc cgggctcgac gacgagcagc ggaagatgta ctccgagaag       900
     gcgctcacca acctaaaccg cctccagaac ctcttcaacg acctcatcga cattgcccgc       960
     ctcgagtaca aggaggacct catcaaccgg tcggtgtttg acctaaagga cctggtcgac      1020
     gaggtggccg agatgcttcg gcccaaggcc gaggaaaagg ggctcgacct ggaggccgac      1080
     gtgtcgcgct tcttcgtcca cgccgatcgc tcccgcgtcc gccaagtgct gaccaacctc      1140
     atcgagaacg gaatcgccta cacggggggc gggtcggtgc ggtgccgggt gcagcggcgc      1200
     cttgacaagg tccgcgtgga ggtcgtggac acggggcagg gcatcgacga agaccacctc      1260
     gaccgcatct tcgaacgctt ctaccgggtg gacccggacc gctcccgcga gagtggggga      1320
     accgggctcg ggctcagcat cgtcaagcag atcctgcagg cccacggcga agacatccac      1380
     gtcgagagca ccaagggacg agggacccga ttctggtttg agcttcccta cgagccggag      1440
     ccggaagccg ttgaggcgta g                                                1461
//

If you have problems or comments...

PBIL Back to PBIL home page