(data stored in ACNUC30630 zone)

EMBL: FP565814.PE679

FP565814.PE679       Location/Qualifiers
FT   CDS_pept        825793..826212
FT                   /transl_table=11
FT                   /locus_tag="SRM_00679"
FT                   /product="conserved hypothetical protein containing HEPN
FT                   domain"
FT                   /db_xref="EnsemblGenomes-Gn:SRM_00679"
FT                   /db_xref="EnsemblGenomes-Tr:CBH23600"
FT                   /db_xref="InterPro:IPR007842"
FT                   /db_xref="UniProtKB/TrEMBL:D5H6E5"
FT                   /protein_id="CBH23600.1"
FT                   /translation="MPSGKRRRPDDPWAWMDRARSNLIRARQRLPNVYLEDLCFDAQQA
FT                   AEKALKALCIERGIEFPYVHDLARLITLLQDEGQPVPDEVTEAGRLTRYAVFTRYPGLD
FT                   DPVTEEDHNRAVSIAERVVEWVEDRLDAGGGTPDS"
     atgccgagcg gaaagcgacg gcgtcctgac gatccgtggg cctggatgga tcgggcgcgt        60
     agcaacctga ttcgagcccg acaacggctc ccgaatgtgt acctagaaga tctctgtttc       120
     gatgcccaac aagccgccga gaaagccctc aaggccctct gtatcgagcg gggcattgag       180
     tttccctacg tgcacgacct cgctcggctg atcactttgc ttcaggatga aggacagccc       240
     gtgcccgatg aagtgacgga ggccgggcgg ctcacgcgct atgctgtatt tacccgctat       300
     ccggggctgg acgatccggt gaccgaggaa gaccacaacc gggcggtatc catcgcagaa       360
     cgggtcgtcg agtgggtgga agaccgcctc gacgcgggtg gggggacacc agattcataa       420
//

If you have problems or comments...

PBIL Back to PBIL home page