(data stored in ACNUC30630 zone)

EMBL: FP565814.PE688

FP565814.PE688       Location/Qualifiers
FT   CDS_pept        835079..835285
FT                   /transl_table=11
FT                   /locus_tag="SRM_00688"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SRM_00688"
FT                   /db_xref="EnsemblGenomes-Tr:CBH23609"
FT                   /db_xref="UniProtKB/TrEMBL:D5H6F4"
FT                   /protein_id="CBH23609.1"
FT                   /translation="MGLRKKGRPEGLPLCLGGKKVPLGATLPDIRWAEHKVADWSVARH
FT                   EQMRHEPEKIAVSTEKIPSQRPK"
     atgggccttc gcaagaaagg ccgaccggag ggcctgccgc tttgcctcgg cggcaaaaaa        60
     gtgcccttgg gcgcgacgct ccctgacatt cgctgggctg agcacaaagt cgcagattgg       120
     tccgtcgcca gacacgagca gatgcggcat gaacccgaga aaattgctgt ttcgacggag       180
     aaaatcccgt ctcagcggcc caaatag                                           207
//

If you have problems or comments...

PBIL Back to PBIL home page