(data stored in ACNUC30630 zone)

EMBL: FP565814.PE689

FP565814.PE689       Location/Qualifiers
FT   CDS_pept        836643..837950
FT                   /transl_table=11
FT                   /locus_tag="SRM_00689"
FT                   /product="Chain length determinant protein"
FT                   /db_xref="EnsemblGenomes-Gn:SRM_00689"
FT                   /db_xref="EnsemblGenomes-Tr:CBH23610"
FT                   /db_xref="GOA:D5H6F5"
FT                   /db_xref="InterPro:IPR003856"
FT                   /db_xref="InterPro:IPR032807"
FT                   /db_xref="UniProtKB/TrEMBL:D5H6F5"
FT                   /protein_id="CBH23610.1"
FT                   /translation="MSDSEPTPSRDGGPRGSRPGRRMPPPEDEITLMELIVTLSRGRGL
FT                   IVLSVVGIGLLGVLYSVATPSRYTAESKVIREAGEGGGGPSLPSGIGGIAGGLGIDIGG
FT                   GGGVGLSPASYPEIATSREVRLAVARDTFYFPSIGRRTTFVDYVNRPPGTLDQILSYTV
FT                   YLPWTVKGALGSLIGSGEGKRSAGTDSTGTLIYPTEEEEEAISALGEMVSASVSESGAL
FT                   EGGSGLMTVSASSGNPRLSARLNERFIEHLRTRVRELQTEKTRRNLRFVEKRFEEVKQE
FT                   LDAAENRLVQFLERNKGVLAAGSKPQLESRRERLRREVGFKEQLYSQMQKQVTQTRLQL
FT                   QKEQPVVTIAEKPAPPAGPSAPNRTLNVVLSLFLGGLFGVGATFFRSAIQNQEDDDEAQ
FT                   EQIQEVQKAWKPSGIVEGVREELGIENDPEGSLTQR"
     atgagcgact ctgagcctac tccatcaagg gatggcggcc cgcgagggtc tcggccagga        60
     aggcgaatgc ctccacctga agatgaaatt accctcatgg agctgatcgt cactctgagc       120
     cgcgggcgag ggctgattgt gctttcggtt gttgggattg gccttctcgg tgttctctat       180
     tcggtagcga caccctcgag gtatactgcc gagtcgaaag tcatccgaga agctggagaa       240
     gggggaggcg ggcccagttt gccgagtggt atcgggggga tcgcaggtgg actcggtatt       300
     gacatcgggg gaggaggtgg cgttgggctc tcgccggcgt cgtacccgga aattgcgaca       360
     agccgagaag tccgtttggc agtagcgcgg gatacgtttt atttcccgtc gattgggcgg       420
     cgcacgacat tcgtagacta cgtaaacagg ccacctggta cacttgatca aatcctgtct       480
     tacaccgtgt acctaccgtg gacggtgaaa ggggcactgg gtagcctcat cggtagcggc       540
     gaagggaagc gttctgccgg aaccgacagt acgggaacgc tcatctaccc gactgaagaa       600
     gaagaggaag cgataagtgc gctgggcgag atggtttctg cttcggtttc cgagtccgga       660
     gcattggagg gaggaagtgg cctgatgacg gtctctgcat cgtcaggcaa tccaaggcta       720
     tcggcgcggc tcaacgaacg cttcatagag catcttcgca cccgcgtccg agagctgcag       780
     acggagaaaa cgcgaagaaa cctgcggttt gtcgagaagc ggtttgaaga agtaaagcaa       840
     gaacttgatg ctgcagaaaa ccgtctggtc cagtttctcg agcgaaacaa gggcgtcctg       900
     gctgcaggta gcaagcctca gcttgagtcc cgtagggagc gtctccgccg ggaagtggga       960
     tttaaagagc agctctacag ccagatgcag aagcaggtta cccagacccg acttcaactt      1020
     caaaaggagc agccagttgt cacgattgct gagaagccgg caccaccagc agggccgagc      1080
     gcgccgaacc gaacgctgaa cgttgtgcta tcgcttttcc ttggcggact gtttggggtg      1140
     ggtgctactt ttttccgatc ggcgatccag aatcaagagg acgacgacga agctcaggag      1200
     caaattcagg aagttcaaaa agcatggaag ccgtctggaa ttgtggaagg tgtgcgagaa      1260
     gagctcggga tcgagaacga ccctgaaggc tccctcaccc agcggtaa                   1308
//

If you have problems or comments...

PBIL Back to PBIL home page